Collection

1998 Annual Conference

Authors

Salim A. Elwazani

Session 3606 Models for Lighting Design Education Salim A. Elwazani Bowling Green State University IntroductionWhile educators assure the need for equipping architecture and design students withlighting design knowledge,1 the nature of the teaching methods employed in imparting thatknowledge is not easy to define. The mere number and diversified orientations of academicprograms speak for the enormous proportions of such a task. However, lighting educatorsare familiar with one or more methods of instruction that contribute to developing

Collection

1998 Annual Conference

Authors

Douglas G. Schmucker

acommercially available children's toy consisting ofplastic beams and columns, each cast in a wide-flange (“I-beam”) shape. Figure 1 shows a typical10-story office building constructed from the set.From the constructed models, the student can see firsthand the "actual" structure that is represented by the Figure 1: 10-Story Office Building made from Page 3.413.2drawings. Additionally, the small scale of the model the Girder & Panel Building Set.facilitates an understanding of the entire structural system.These sets are also exceptionally useful for demonstrating the behavioral differences betweenrigid frames, braced frames, and shear

Collection

1998 Annual Conference

Authors

Gary H. McDonald; Charles V. Knight

justcompleted this process for the Mechanical Engineering Laboratory. The previous lab (a thermalscience lab with 1 credit hour) used no computer data acquisition while the new lab (having bothmechanics and thermal science components with 1 hour lecture and 1 hour lab) has the electronicinstrumentation and data acquisition integrated throughout. No new laboratory systems werepurchased as on-hand systems were retrofitted with new instrumentation and data acquisitionusing LabVIEW (Laboratory Virtual Instrument Engineering Workbench) [1]. The developmentof the new lab provided a challenge and comprehensive learning experience for the responsiblefaculty member while saving the university money. The paper describes many aspects ofuniversity related

Collection

1998 Annual Conference

Authors

Lyn Mowafy

anational resource center for developing, managing, evaluating, and distributing educationalmaterials for SMT programs nationwide. These products are to be characterized by their balanceof practical knowledge with mathematical and scientific understanding, relevancy to industryworkforce needs, and adaptability under rapid technological change. To meet the challenge,MATEC is creating a curriculum development system that allows individual institutionsopportunities to transition successfully from existing programs as well as service local industrypartner needs. The key features of this system are: 1) the curriculum is modular in design andbased on workplace competencies and, 2) it is delivered to faculty electronically with anaccompanying electronic

Collection

1998 Annual Conference

Authors

Marilyn Barger, Hillsborough Community College

Collection

1998 Annual Conference

Authors

A.O. Richardson

(FFT), entail the repeated multiplication oftwo entities, namely, a filter coefficient and an input signal sample. Powerful processors, such asthe Motorola DSP56002, accomplish a multiply-accumulate('MAC') in one parallel step. Equations(1) and (2) below represent the Finite Impulse Response Filter(FIR) and the Discrete FourierTransform(DFT) showing the 'MAC' nature of the operations.The relationship between a FIR filter's digital input sequence x(n) and digital output sequence y(n)can be written as: N −1 y(n) = ∑ b(i ) x( n − i ) (1) i=0where b(i) are filter coefficients and N is the number of those

Collection

1998 Annual Conference

Authors

Lori S. Cook; Lawrence S. Aft

. Page 3.416.1 1 PROGRAM STRUCTUREThe Industrial Engineering Technology department at SPSU began offering the MSQA in 1991.The program was initially developed to address the response from the professional communityfor a degree that addressed the needs of the practicing quality professional. As such, thecurriculum was developed and the program was structured so that the practicing professionalcould take one course a quarter and finish within three years. The response of the communitywas positive and the program rapidly grew to approximately 100 students.When it was proposed to offer the degree via distance learning on the Internet, the decision wasmade to maintain

Collection

1998 Annual Conference

Authors

Daniel T. Schwartz

Session 2413 A MULTIDISCIPLINARY ELECTROCHEMICAL ENGINEERING LABORATORY COURSE Daniel T. Schwartz Department of Chemical Engineering Box 351750 University of Washington Seattle, WA 98195-1750Roughly 5% of the U.S. gross national product is spent on value-added electrochemical processesor value-degrading electrochemical corrosion.1 This sizable economic impact suggests thatmany, if not most, engineers and scientists will

Collection

1998 Annual Conference

Authors

Richard D'Amato

surveying, flow net construction and an introduction into groundwater flowestimations. The purpose of this paper is to describe this field exercise.II. BACKGROUND Protection of our water resources is a major concern of environmental engineers. Sourcesof fresh water are precious and need to be monitored and protected. Whether through ignorance orcarelessness, our fresh water supply is continually endangered by many of man’s activities. A major source of fresh water is groundwater located in subterranean aquifers. Thisgroundwater can be investigated using monitoring wells. A monitoring well is typically a screenedPVC pipe (Figure 1). It serves as an observation port between the aquifer and the ground surface.For an unconfined aquifer

Collection

1998 Annual Conference

Authors

Will Manion; Ronald Kozlowski; Mike Scott; Lynn E. Katz; Lenly J. Weathers

Session 2251 A Multimedia Based Laboratory Course for Environmental Engineering Lynn E. Katz1, Lenly J. Weathers2, Ronald Kozlowski2, Mike Scott2 and Will Manion2 1 University of Texas at Austin /2University of MaineAbstractThe focus of this project is on the development of interactive multi-media laboratory modules toaccompany a physical laboratory course in environmental engineering process dynamics. Thecourseware modules are intended to enhance the laboratory experience by ensuring that studentshave a firm grasp of

Collection

1998 Annual Conference

Authors

R. Bruce Robinson

able to see pictures and video of real facilities and receive narration while they arelearning about wastewater treatment and then be able to review what they’ve seen after the trip.This paper describes the development of such a “virtual field trip” of a wastewater plant.Because the software is approximately 380 MB in size, it is written on a CD-ROM.Operation of the software: The opening screen is shown in figure 1. The inset photo on thelower right of figure 1 is a video of a chlorination basin weir with sound which plays during theopening screen. By clicking the continue button, the user brings up the overall navigation screenshown in figure 2 which is diagram of a typical activated sludge treatment plant. The studentclicks on one of the

Collection

1998 Annual Conference

Authors

Matt W. Mutka; Betty H. C. Cheng; Diane Rover

machines and dishwashers) and automotive-related systems (e.g., climate control and door controls). The operating system course includes a new module in real-time scheduling, with laboratory projects planned for task allocation in real-time distributed computing systems. Our digital system design course sequence includes the design of application-specific integrated ‘This work is sponsored in part by NSF grants CDA-9700732, CDA-9617310, CCR-9633391, CCR-947318, Page 3.27.1CDA-9529488,ASC-9624149, MIP-9321255. 1 circuits using VLSI and programmable logic, with plans to emphasize

Collection

1998 Annual Conference

Authors

Linda V. Itzoe; Charles A. Gaston; Janice Margle

. For example, the University of Floridaexperienced a dramatic increase in retention associated with a lab-based rather than a lecture-based Introduction to Engineering2. It is important to introduce students to the challenge andexcitement of engineering design early in the college experience for many reasons, some ofwhich are: (1) It shows the relevance and importance of having a good command of basic math andphysics. (ET students in particular tend to be impatient with theory and abstract reasoning if theycannot see practical applications.) (2) It provides a taste of real engineering design. (Those who like it get more excited abouttheir curriculum choice; those who don't like it may choose a different major sooner.) (3) It helps

Collection

1998 Annual Conference

Authors

James A. Houdeshell; Robert Mott

, content, and pedagogy are being developed.Additional objectives are aimed at improving mathematics and science education in grades 11and 12 of secondary schools by providing educational materials that emphasize the application offundamental concepts to authentic applications, typically relevant to manufacturing careers.Faculty development for high school, community college, and university faculty members isanother important objective.Initial funding for the center was for three years from January 1, 1995 through December 31,1997. The work of the center will continue through the end of the year 2000 with three years ofadditional NSF funding. Continuation is planned beyond 2000 with revenues derived from avariety of sources.While based in Dayton

Collection

1998 Annual Conference

Authors

Peter Hartley

#FGSWCVGUVCTVWRHWPFKPIKUCOWUVCEQWTUGNKMGVJKUKUCETGCVKQPFGPQXQYKVJQWVGZCORNGUVQFTCYQPQTHWNN[CFGSWCVGVGZVUCXCKNCDNG6JGKPUVTWEVQTUECPPQVRQUUKDN[IGVTGCF[HQTKVYKVJQWVCORNGTGNGCUGHTQOQTFKPCT[FGOCPFU)KXGPVJQUGEQPFKVKQPUVJGGHHQTVKUYGNNYQTVJOCMKPI+DGNKGXGVJCV0CVWTGCPF*WOCP8CNWGUTGRTGUGPVUCPGZVTGOGN[KORQTVCPVUVGRHQTYCTFKPGPIKPGGTKPIGFWECVKQP %,%/,2*5$3+,& ,1)250$7,21$&+(%( &+,18$ 7KLQJV )DOO $SDUW 1HZ

Collection

1998 Annual Conference

Authors

Amir Mirmiran

evaluating damages and characterizing the integrity of existing structures in general,and infrastructure in particular [5]. Construction industry has adopted new inspection programs withseveral NDT techniques, many of which initiated in the research units of universities, and were thentransferred to the industry for use and further development. However, in most cases, they did notinfiltrate the classrooms. As a result, engineering graduates are not properly trained to utilize NDTequipments. Other countries have placed a greater emphasis on NDT in their education system [6].Similar efforts exist in the U.S., but are rare. Collins and Alexander [1] indicate that proficiency inNDT is best learned hands-on, as industry has found, where all the variables

Collection

1998 Annual Conference

Authors

John D. Clayton; Joseph Rencis, University of Arkansas

matrices. 1. INTRODUCTIONAxisymmetric finite element (FE) models may be used to represent three-dimensional (3-D)structures exhibiting symmetry about a central axis of rotation. For conventional axisymmetricelements to be acceptable for modeling a structure, the body’s geometry, loading, boundaryconditions, and material properties must all be independent of the T coordinate. Three commontypes axisymmetric elasticity elements include the two-node washer, the three-node triangle, andthe general (distorted) four-node quadrilateral. Structures commonly modeled usingaxisymmetric elasticity elements include thick-walled pressure vessels, soil masses subjected tocircular footing loads, and flywheels rotating at

Collection

1998 Annual Conference

Authors

Bahman Motlagh; Alireza Rahrooh

robust behavior. The properchoice of the PID gains is essential for a satisfactory performance. Many attempts for tuning these 1-3controllers are mainly achieved by off-line tests performed on the plant . There are also other more 4-7modem autotuners available . The controller parameters, regardless of their method of tuning,must be retuned after a change of plant parameters due to changing operating points, aging, etc.Therefore, the design of an autotuner that adaptively changes the controller gains could be ofpractical interest. In this paper, neural networks are utilized to design a tuner that changes the PID gains adaptively

Collection

1998 Annual Conference

Authors

M. R. Foster; H. Öz

have been changes in the student culture. The Course of Study forAeronautical and Astronautical Engineering at The Ohio State University changed significantlyonce before, in 1970, when the university made a transition from a 5-year B. S. degree to whathad become the standard everywhere: the 4-year degree. Since that time, only minimal changeshave occurred.Though the curriculum has remained essentially static, the student world has changed dramat-ically. Sociologists have thoroughly documented many of those changes; one of the mostilluminating is the cultural analysis by Postman1 in a popular account of the cultural shifts due tothe impact of television. Of prime concern to engineering educators are two of his points: (1)Knowledge has become

Collection

1998 Annual Conference

Authors

James Rehg; Sohail Anwar

Case is to provide a medium through which learning (e.g., analyzing, applying knowledge, reasoning, drawing conclusions) takes place. Imparting additional specific information is relatively minor and coincidental. A good case: 1. Is taken from real life (a necessity). 2. Consists of one or more parts, each part usually ending with problems and/or points for discussion. 3. Includes sufficient data for the reader to treat problems and issues. To make a case believable to the reader, a good case usually includes: Page 3.423.3 1. Setting 2. Personalities 3. Sequence of events

Collection

1998 Annual Conference

Authors

Mark A. Palmer; Gary E. Wnek; John B. Hudson

6HVVLRQ 1(:$3352$&+(6)25$1,1752'8&725<0$7(5,$/6 6&,(1&(&2856( 0DUN$3DOPHU*DU\(:QHN-RKQ%+XGVRQ 9LUJLQLD&RPPRQZHDOWK8QLYHUVLW\ 5HQVVHODHU3RO\WHFKQLF,QVWLWXWH $%675$&7$PDWHULDOVVFLHQFHFRXUVHIRUJHQHUDOHQJLQHHULQJVWXGHQWVKDVEHHQGHYHORSHGRYHUWKHODVWVHYHUDO\HDUVVRWKDWWKHFRXUVHVHUYHVQRWDVDQLQWURGXFWLRQWRWKHGLVFLSOLQHIRUPDWHULDOVPDMRUVEXWDFRXUVHWKDWDOORZVWKHJHQHUDOHQJLQHHULQJVWXGHQWWRDSSO

Collection

1998 Annual Conference

Authors

Jeffrey P. Freidberg

ofresearch. To establish a reasonably complete bionuclear activity probably requires at least six orseven committed faculty members covering the three basic classes of applications; (1) thetreatment of illnesses (e.g. BNCT, development of pharmaceuticals), (2) medical and biologicaldiagnostics (e.g. imaging techniques) and (3) health physics issues (e.g. the linear extrapolationhypothesis). University programs of this size or larger, focusing on the related nuclearengineering technology rather than the pure biological sciences, will help to create an identity forbionuclear technology and establish that such activities should naturally reside in nuclearengineering departments.Towards the goal of establishing a unified discipline we have instituted a

Collection

1998 Annual Conference

Authors

Mariusz Jankowski

New electronic courseware modules for selected upper-level electrical engineering courses. Mariusz Jankowski University of Southern MaineAbstractA recent award from the National Science Foundation (DUE-III program) was used toestablish a computer-integrated classroom to support instruction in selectedundergraduate electrical engineering courses. The new classroom is being used to addressthree pedagogically fundamental problems:(1) insufficient mastery of engineering mathematics by many students,(2) student passivity within the traditional lecture format,(3) insufficient use of computation and visualization in the learning process,New electronic

Collection

1998 Annual Conference

Authors

J. A. Isaacs

, ecolabeling) and issuesin disposal strategies (landfill, incineration, reuse and recycling) are debated. The difficultiesassociated with environmental impact assessments and the development of decision analysistools to weigh the tradeoffs in technical, economic and environmental performance of theproduct are discussed. This course offers new perspectives for enhancing the breadth ofengineering education, and has been welcomed as a complement to the existing curriculum.1. IntroductionWith the increasing importance of commercialization and liabilities of materials, themanufacturing cost for part fabrication and the environmental consequences of using thatmaterial are becoming significant for characterizing the success and performance of a material,and

Collection

1998 Annual Conference

Authors

Warren R. Hill

Collection

1998 Annual Conference

Authors

Jack Waintraub

Semester Semester 1 2 3 4 MCT 101 MCT 106 MCT 205 MCT 202 Intro to Technology Automated Systems Manufacturing Processes & Special Topics in Engineering Quality Management Technology2CR 3 HRS 4 CR 6 HRS 4 CR 6 HRS 3 CR 3 HRS Social Science/Humanities MCT 104 MCT 203 MCT 206

Collection

1998 Annual Conference

Authors

Peter C.M. Burton; Fred Payne; Dinesh Kant

Certificate: 1 semester full time study ( 8 courses)Graduate Diploma: 2 semesters full time study ( 16 courses)Master’s in Electronics: 3 semesters full time study ( 16 courses plus minor thesis) Page 3.427.4 Note: one course corresponds to two contact hours per week for the duration of the semester Electronics ClusterThree focus areas are defined: Electronic Design, Electronic Manufacturing, Signal Processing.Students are required to take Integrated Circuit Design Approaches, ElectromagneticCompatibility and Test and Design for Test regardless of the focus area. They then may choose aminimum of one course for the

Collection

1998 Annual Conference

Authors

K. Hing Pang

-forward orfeed-back controllers to determine required refrigerant flow rates and the resulting compressorcapacities. This technique often results in many control loops, each requiring many iterations toconverge. This paper is the result of a senior project (1) undertaken by a chemical engineeringsenior at Cal Poly, Pomona. It describes how HYSYS has been used successfully to design arefrigeration system with 4 compressors, 13 heat exchangers and 4 flash drums without resortingto numerous control and recycle loops. The intent of this paper is not to provide a rigorouscomparison between simulators, but to focus on a special technique used for solving industrialrefrigeration design problems. It is expected that the same technique can be applied to

Collection

1998 Annual Conference

Authors

Francis J. Doyle III

Session 3513 Novel Use of the World Wide Web for Undergraduate Process Control Instruction Francis J. Doyle III Dept. of Chemical Engineering, University of Delaware AbstractIt is becoming common practice to use the World Wide Web (WWW) as a vehicle tocommunicate valuable course-related information to the student (see, e.g., [1]). In this paper, theauthor describes first-hand experience with the Serf (Server-side educational records facilitator)package, an environment which exploits a Web interface to access a

Collection

1998 Annual Conference

Authors

Surya Kalidindi; Philip Perdikaris; John Lannutti; John DiNardo; Gary Ruff; Charles McMahon; Jed S. Lyons; Alan Lawley; Linda Schadler

effective learning supplements.1. INTRODUCTION The Gateway Engineering Education Coalition is a collaborative program of 10institutions, supported by the Engineering Directorate of the National Science Foundation. Onefocus of the Coalition is on improving "how we teach" as opposed to "what we teach." Teams offaculty from the various institutions have developed innovative approaches and learning tools forseven distinct curricular areas. One of these, the Materials Program Area team, is involved withthe development of course materials for teaching material science and engineering at theintroductory level within a topical range from atomic structure to materials processing. The twomajor thrusts in this area have been:x Solid State