Collection

1998 Annual Conference

Authors

M. Christine Miller; Karthikeyan Subbiah; Dale A. Wilson

Session 2566 EVALUATION OF THE EFFECTIVENESS OF DESIGN TEAM-BUILDING: A 45-MINUTE INVESTMENT PAYS OFF Dale A. Wilson, M. Christine Miller, Karthikeyan Subbiah Tennessee Technological UniversityAbstractThis paper discusses an experiment to determine whether team-building activities couldinfluence the outcome of student group projects in a senior mechanical engineering machinedesign class. This educational experiment was an offshoot of a 3-year ongoing investigation offactors that influence the costs of new product development. The results from this preliminaryinvestigation show that the student

Collection

1998 Annual Conference

Authors

Robert A. Hall; Mark W. McK. Bannatyne

1 Session 3538 Facing Technological Disenfranchisement In The Global Community Dr. Mark W. McK. Bannatyne, Professor Robert A. Hall Purdue University/State Dept. of Corrections, New HampshireIntroductionAs professionals in what we might be pleased to call the "technologically progressive nations",we have access to data systems and networks that are able to both manage and provide bits andbytes in quantities that just a few years ago were considered a dream of things to come

Collection

1998 Annual Conference

Authors

William J. de Kryger; David A. Lopez

[GZEJCPIGKUVQRTQXKFGCPQRRQTVWPKV[HQTGCEJITQWRVQGZRGTKGPEGVJGVGEJPKECNEWNVWTCNCPFUQEKCNCURGEVUQHGCEJQVJGTIUEQWPVT[%/7JCUVCMGPQPVJGTGURQPUKDKNKV[QHFGXGNQRKPICPFEQQTFKPCVKPIVGEJPKECNRTQLGEVUUJCTGFD[DQVJWPKXGTUKVKGU6JGRTQLGEVUWUWCNN[HQEWUQPCPCURGEVQHCWVQOQVKXGCPFQTGNGEVTQPKEVGEJPQNQI[CPFTGSWKTGVJGRCTVKEKRCVKQPQHUVWFGPVUCPFHCEWNV[HTQODQVJEQWPVTKGU2TQLGEVFGUKIPCPFKORNGOGPVCVKQPWUWCNN[KPXQNXGTGUGCTEJU[UVGOUGPIKPGGTKPICPFCRTCEVKECNCRRNKECVKQPYKVJKPKPFWUVT[I. INTRODUCTIONA. History and Description of the ExchangeThe genesis of this exchange has its roots in a Sister Cities program which was initiated in 1989,with Vladimir, Russia, a city of about 400,000 people. Vladimir is also the home of VladimirState University (VSU), the premier engineering university in that region of

Collection

1998 Annual Conference

Authors

David E. Goldberg; W. Brenton Hall; Lindsay Krussow; Eunice Lee; Aaron Walker

Session 2525 Teamwork for a Quality Education:1 Low-Cost, E ective Educational Reform through a Department-Wide Competition of Teams David E. Goldberg, W. Brenton Hall, Lindsay Krussow, Eunice Lee, & Aaron Walker University of Illinois at Urbana-Champaign1 IntroductionCurriculum reform is all around us. The NSF Coalitions Coleman, 1996 are the most visibleof the e orts, but reform is occurring both nationally and internationally, the direct result ofa combination of higher demand for fully assembled" engineers, the

Collection

1998 Annual Conference

Authors

Richard K. Keplar; Eugene F. Smith; Vernon W. Lewis

Session 3547 TS/ 2 A CURRICULUM MODEL FOR PREPARING CET GRADUATES FOR POSITIONS IN STRUCTURAL DESIGN Dr. Eugene F. Smith, P.E., Richard K. Keplar, P.E., and Vernon W. Lewis, P.E. Civil Engineering Technology Program, Department of Engineering Technology Old Dominion UniversityAbstractThis paper presents a curriculum model for preparing Civil-Engineering Technology (CET)baccalaureate degree graduates for positions in structural design. The evolution of this modelwas dictated in large measure by the nature of design positions that are available to civilengineering technology graduates in Virginia

Collection

1998 Annual Conference

Authors

Frank Wicks

Session 2533 DEMONSTRATIONS AND CAMPUS FACILITIES FIELD TRIPS FOR A HEATING, VENTILATION AND AIR CONDITIONING COURSE Frank Wicks Union College Schenectady, New York, 12308ABSTRACT A field trip is taken to our adjacent physical This paper will describe a set of class room facilities building where the operation of the centraldemonstrations and on campus field trips that have

Collection

1998 Annual Conference

Authors

Kevin M. Hubbard

Session 2663 Development of a Relay Ladder Logic Programming and Simulation Tool with Graphical User Interface Kevin M. Hubbard, Ph.D., CMfgE University of Missouri-RollaI. AbstractTwo software packages have been developed in the Computer Integrated ManufacturingLaboratory of the University of Missouri-Rolla's Engineering Management Department. Thefirst, LadderCAD, is a relay ladder logic programming environment. It features: • "Point and Click" graphical user interface based ladder logic program construction. • Forward Interpretation: The generation of an

Collection

1998 Annual Conference

Authors

Suresh Muknahallipatna; Jerry Hamann

Session 3620 Distributed Instrumentation and Computation: A Look at What’s Out on the End of the Internet Jerry C. Hamann, Suresh Muknahallipatna University of WyomingAbstractThis paper provides an overview of some emerging uses of the internet in engineering educationand research. Included are descriptions of unique instrumentation and laboratory facilities madeavailable to the world community by way of the ubiquitous web.1. IntroductionThe internet is truly becoming commonplace in education, industry and commerce. It provides achannel for entertainment

Collection

1998 Annual Conference

Authors

Douglas H. Baxter

Session 2238 Engineering Graphics And Computer Aided Design: A Foundation To Engineering Design And Analysis Douglas H. Baxter Rensselaer Polytechnic Institute1.0 AbstractWith the advent of solid modeling, the importance of engineering graphics has beenemphasized. Many employers hiring engineers expect their new engineers to have somesolid modeling expertise from their academic experience. As with many engineeringschools, engineering graphics was greatly curtailed at Rensselaer during the 1980’s.When engineering graphics was reintroduced at Rensselaer as a required freshman

Collection

1998 Annual Conference

Authors

H. Öner Yurtseven; Patricia L. Fox

SESSION 1647 ENGINEERING TECHNOLOGY AND ENGINEERING AT IUPUI: A Harmonious and Profitable Co-Existence H. Oner Yurtseven, Patricia L. Fox Indiana University Purdue University IndianapolisAbstractCurrently, there are less than twenty engineering and engineering technologyschools in the US in which the administrations of engineering and engineeringtechnology programs are merged and a dean or director maintains academic andfiscal responsibility for both programs. The Purdue School of Engineering andTechnology at Indiana University Purdue University Indianapolis (IUPUI), hasfollowed this administrative model since 1972. The school

Collection

1998 Annual Conference

Authors

John Stratton

Session 2647 How Are The Engineering Technology Graduates Doing? A Rochester Institute of Technology 25 Year Survey John Stratton Rochester Institute of TechnologyAbstract: A study of the long term progress of the baccalaureate engineering technology (ET) graduates from the Rochester Institute of Technology (RIT) was undertaken during 1997. Approximately 550 of RIT’s 3,000 graduates and 250 of their direct supervisors replied to the survey. The results and analysis show that RIT’s ET alumni are performing effectively in a

Collection

1998 Annual Conference

Authors

Barbara Olds

Session 2761 How Are We Doing? Assessing a Writing-Intensive Introductory Humanities and Social Sciences Course Barbara M. Olds Colorado School of MinesNature and Human Values (NHV) is a required, 4-credit, writing-intensive class, the first coursein the humanities and social sciences core at the Colorado School of Mines (CSM). The courseis, according to the common syllabus, “designed to introduce prospective engineers, appliedscientists, and economists to the inextricable, complex, and dynamic interrelationships that existbetween and among human systems

Collection

1998 Annual Conference

Authors

Ronald J. Bennett

Session 2642Industry/Academia Collaboration: Developing a New Master of Science in Technology Management Degree Program Ronald J. Bennett, Ph.D. Director and Chair Manufacturing Systems and Engineering Page 3.337.1 1AbstractThe University of St. Thomas graduate programs serve a working adult population centered inthe Minneapolis/St. Paul metropolitan area. Degree programs in business, software,manufacturing systems and engineering are provided through a multitude of delivery modesincluding traditional classes, company on-site classes, use

Collection

1998 Annual Conference

Authors

Suzanne Keilson

Session 3592 Infusing a multicultural approach to education in the engineering and science curriculum Suzanne Keilson, Ph.D. Department of Electrical Engineering and Engineering Science Loyola College, Baltimore, MD 21210 keilson@loyola.edu Abstract Over the summer of 1997 I participated in a workshop for infusing multiculturalismacross the curriculum. The workshop was based upon guidelines established by the AmericanAssociation of Colleges and Universities (AAC&U)1 and has been

Collection

1998 Annual Conference

Authors

Stephanie Goldberg

Session 3560 A Plan to Retain Women Students in an Electrical Engineering Technology Program Stephanie Goldberg Department of Technology Buffalo State CollegeAbstractAn innovative plan has been developed to secure the retention of women students in a four-yearElectrical Engineering Technology program. Our aim is to recruit six to ten women and movethem as a group through the complete program. Bolstering confidence levels, developinghands-on skills, and forming coping strategies are all addressed in unique and

Collection

1998 Annual Conference

Authors

Richard R. Schultz

Session 3532 A Practical Introduction to Digital Signal Processing through Microsoft Visual C++ and LabVIEW Programming* Richard R. Schultz University of North Dakota rschultz@nyquist.ee.und.nodak.edu AbstractConventional wisdom has relegated the introduction of digital signal processing (DSP) fundamentals tothe senior year of the electrical and computer engineering curriculum, since a background in complexvariables is required for the frequency domain analysis and design of digital

Collection

1998 Annual Conference

Authors

Sherry Glenn; John Hawley; Hillel Kumin; Billy Crynes

. The measurement for slump is made from the top of the mold to what point of the concrete specimen?8. While the technician is checking the slump of the concrete, there is a decided falling away or shearing off of concrete from one side of the sample. What should the technician do? Page 3.484.1T119_rev_stu Concrete-57 January 1998

Collection

1998 Annual Conference

Authors

W.R. Kaminski

2648 A SERIES OF HEAT TRANSFER EXPERIMENTS FOR THE MECHANICAL ENGINEERING TECHNOLOGY STUDENT W.R. Kaminski Professor and Coordinator Mechanical Engineering Technology Central Washington University Ellensburg, WA 98926 Abstract A series of five heat transfer experiments that are used to teach the laboratory component fora Mechanical Engineering Technology (MET) heat transfer course at Central Washington

Collection

1998 Annual Conference

Authors

J.P. Agrawal; Omer Farook; Chandra R. Sekhar

6'#/$7+.&+0)#56*'(1%75+0#%1745'10 '.'%6410+%241,'%6'0)+0''4+0) ,2#ITCYCN1OGT(CTQQMCPF%45GMJCT 2WTFWG7PKXGTUKV[%CNWOGV *COOQPF+0 The paper presents the teaching methodology of a new course in Electronic Project Engineering in the Bachelor degree program of the Electrical Engineering Technology. This course is a precursor to the course in Senior Design Project. The course contains two components: (1) Introducing the principles and concepts of project planning and engineering and (2) the execution of a demonstrable project that is run very close to the principles learned. The first component is conducted through a

Collection

1998 Annual Conference

Authors

Shomir Sil; Sashi Sekhar; Chandra R. Sekhar

Session 1547 A Technology Curriculum for the Year 2000 and Beyond Minor in Management Program for Technology Sashi Sekhar, Shomir Sil/Chandra Sekhar Department of Management/Department of Electrical Engineering Technology Purdue University Calumet AbstractWhether it be in Industry or in the Service sector, today’s Technology graduates are developing,implementing, and maintaining systems that are the foundations of the American economy. So,what is next for these individuals who understand the technical aspects, but not necessarily

Collection

1998 Annual Conference

Authors

Renecia Jones; Kerric Bennett; Ganelle Grace; Bala Ram

Session Number 3657UNDERGRADUATE PORTFOLIOS IN INDUSTRIAL ENGINEERING AT NORTH CAROLINA A&T STATE UNIVERSITY Ganelle Grace, Ph.D., Bala Ram, Ph.D., P.E., Renecia Jones, Kerric Bennett North Carolina A&T State University Page 3.594.1ABSTRACT This paper addresses the following issues: an implementation model for undergraduateportfolios, a survey of other internal assessment tools, and the success of the implementation. In the Spring semester of 1997, the Department of Industrial Engineering at NorthCarolina A&T State University decided that a

Collection

1998 Annual Conference

Authors

Charlie P. Edmonson

Session 1547 USE OF A PHYSICAL SIMULATION TO TEACH ASSEMBLY LINE AND KAIZEN CONCEPTS CHARLIE P. EDMONSON The University of DaytonABSTRACTMany students in lower level courses are not familiar with manufacturing or assembly plants andthus have trouble understanding many of the concepts pertaining to production and operationsmanagement. Concepts such as scheduling, assembly line balancing, Just-in-time, theory ofconstraints, etc., are difficult to grasp without some physical demonstration. This paperdiscusses a simulation exercise used to aid in teaching these

Conference Session

Integrating Design in the Freshman Year (3553)

Collection

1998 Annual Conference

Authors

Sharon Fellows, Watson School of Engineering and Applied Science SUNY -Binghamton; Richard Culver, Watson School of Engineering and Applied Science SUNY -Binghamton

Tagged Divisions

Freshman Programs (FPD)

Session 3553 Using Assistive Devices for the Disabled to Teach Design in a Freshman Engineering Course Dick Culver, Sharon Fellows Watson School of Engineering and Applied Science SUNY-BinghamtonAn effective freshman design project must meet several criteria: motivate students, provide aclear model of the design process, give adequate opportunity to practice the various skills beingtaught in the freshman year and fit within a limited time and financial budget. In the Design,Technology and Communications (DTeC) program at SUNY

Collection

1998 Annual Conference

Authors

Virendra K. Varma

Session 1148 Applying the Rigors of Internship Principles to a Successful Co-Op Design Virendra K. Varma, Ph.D., P.E. Missouri Western State CollegeAbstract: The major purpose of an internship is to develop an individual’s occupationalcompetence by application of theoretical knowledge attained through successful completion ofcourse work which is related to the individual’s profession. An internship provides a linkbetween theory and practice, and gives an individual a first-hand experience of involvement inreal jobs. Problem-solving skills are

Collection

1998 Annual Conference

Authors

Arnold F. Johnson

Session 2522 Capstone Design via Distance Education A DESIGN Partnership Including Industry and Higher Education Arnold F. Johnson University of North DakotaAbstractA unique capstone design course was offered by the University of North Dakota (UND) to distanceeducation students at their industry work sites using company based projects and industry mentors for thefirst time in the fall of 1996; the course was offered again in the fall of 1997. The structure of thecapstone design course, the university-industry partnership, the selection and

Collection

1998 Annual Conference

Authors

Sameer Kumar; John Walker; Jeffrey A. Jalkio; James Rehg

Session 2522Distance Learning, an Enabling Approach in Academia/Industry Partnerships Sameer Kumar, Ph.D. Professor Department of Manufacturing Systems and Engineering University of St. Thomas, St. Paul, Minnesota John Walker Visiting Professor Department of Manufacturing Systems and Engineering University of St. Thomas, St. Paul, Minnesota Jeffrey A. Jalkio, Ph.D. Assistant Professor Department of Manufacturing Systems and Engineering

Collection

1998 Annual Conference

Authors

Michael Safoutin; Jens Jorgensen; Joseph A. Heim; Dale E. Calkins

Session 3666 “The Integrated Learning Factory: An Educational Paradigm’s First Year of Operation” Dale Calkins, Jens Jorgensen, Michael Safoutin, Joseph Heim University of Washington Abstract The Integrated Learning Factory (ILF) is a facility that supports product realizationwithin a new practice based engineering curriculum developed and adopted by the participatinguniversities of the Manufacturing Engineering Education Partnership (MEEP). MEEP comprisesthe University of Washington, Penn State University and the University of

Collection

1998 Annual Conference

Authors

Ingrid H. Soudek

Session 3661 Getting Started, Surviving and Thriving: A Brief History of the Division of Technology, Culture, and Communication in the School of Engineering and Applied Science Ingrid H. Soudek Division of Technology, Culture, and Communication University of VirginiaThe idea of professional engineers who are well-trained technically, humanistically oriented,and conscious of their social obligations, is not a new one, although there is much more focus oncreating “well-rounded” engineers in present day engineering education. In the

Collection

1998 Annual Conference

Authors

James P. Solti; James M., Jr. Greer

Enhancing Critical Thinking Skills Through the Incorporation of an Open-Ended and Ill-Defined Project in a Technical Core Course James P. Solti and James M. Greer, Jr. Department of Engineering Mechanics United States Air Force AcademyIntroductionEngineering Mechanics 200 (EM 200) - Fundamentals of Mechanics is an introductory“core” course which all students are required to complete prior to the start of their fifthsemester at the U.S. Air Force Academy (USAFA). This course offers an integratedintroduction to the Mechanics of Materials and to Statics. The course is not a preparatorycourse for engineers in which students are asked to learn

Collection

1998 Annual Conference

Authors

Marybeth Lima

Session 1308 Principles of living systems and engineering design for freshmen level students in biological engineering: design of a tiger habitat Marybeth Lima Louisiana State UniversityAbstractThe design of a tiger habitat for LSU mascot Mike the Tiger was assigned as a class project forBE 1252: Biology in Engineering, a required freshmen level course in the BiologicalEngineering Curriculum. This project was chosen because of its relevance in illustrating theboundary between living systems (animal, human and plant) and the environment, because of itsproximity to and