Conference Session

e-Learning Course Development and Instruction

Collection

2010 Annual Conference & Exposition

Authors

Michael Kozak, University of Dayton

Tagged Divisions

Continuing Professional Development

question regarding perceived preparedness was quantified by coding responses asfollows: Strongly agree was assigned a 1, agree a 2, neutral a 3, disagree a 4, and stronglydisagree a 5. A one sample t test was performed on the differences in the ratings for individualdata. Pearson’s correlation coefficient was determined between the individual studentperformances for all eight questions and the individual student perceived perception ofunderstanding.ResultsThree students chose to not have their responses included in the study. Eight students did notcomplete or return all sections of the survey and their answers were not included in the analysis.That left thirty-nine students that were used for the analysis. Table 1 shows the proportion ofcorrect

Conference Session

Multidisciplinary First Year Programs

Collection

2010 Annual Conference & Exposition

Authors

Andrew Lowery, West Virginia University; Steve Kane, West Virginia University; Vicki Kane, West Virginia University; Robin Hensel, West Virginia University; Gary Ganser, West Virginia University

Tagged Divisions

First-Year Programs

diligently in both subjects. Sincestudents historically perform well in freshman engineering, the expected result, if this experimentis successful, would be improved grades in calculus.In this experiment, three joint projects were defined to illustrate the following math concepts:(1) functions, composition of functions, discrete and continuous variables; (2) exponentialgrowth and decay; and (3) rate of change, specifically focusing on Newton’s Law of Cooling.Each project presents a fictitious real world problem that puts the students in the context of beingthe consulting group that needs to develop the solution to the problem. The problem must beunderstood analytically (the part done in math recitation and continued for homework) as well

Conference Session

Sustainable Energy Education

Collection

2010 Annual Conference & Exposition

Authors

Joshua Goldade, University of North Dakota; Tessa Haagenson, University of North Dakota; Hossein Salehfar, University of North Dakota; Mike Mann, University of North Dakota

Tagged Divisions

Energy Conversion and Conservation

curriculum. Page 15.357.14Bibliography[1] Bacharach, Inc. 2009. [Online]. Available: http://www.bacharach-inc.com/leakator-10.htm.[2] Barbir, Frano. PEM Fuel Cells. Burlington, MA: Elsevier Academic Press. 2005.[3] Chroma Ate Inc. 2010. [Online]. Available: http://www.chromaate.com/product/63200_series_High_Power_DC_Electronic_Load.htm.[4] EG&G Technical Services, Inc., Fuel Cell Handbook (Seventh Edition). Prepared for the U.S. Department of Energy. 2004. [Online] Available: http://www.netl.doe.gov/technologies/coalpower/fuelcells/seca/refshelf.html.[5] Engineering Accreditation Commission. (Accreditation Board of Engineering Technology

Conference Session

Embedded System Design

Collection

2010 Annual Conference & Exposition

Authors

Paul Weber, Lake Superior State University

Tagged Divisions

Electrical and Computer

a group of their peers that the application is commercially and ethically viable. Surveyresults were taken from three different classes using a 9-value Likert scale. The current researchwill explain the pedagogical basis for using competition in such presentations and a discussion oftrade-offs, observations of how to implement such presentations at different student levels, andtheir impact on student motivation.1. IntroductionIt is the role of every engineering degree-granting institution to make sure their students have asolid background in the core topics of their specific field as well as engineering in general. Asengineers, they must then be able to integrate this knowledge in order to utilize a more holisticview4 when designing

Conference Session

Issues and Directions in ET Education & Administration: Part III

Collection

2010 Annual Conference & Exposition

Authors

Saeed Khan, Kansas State University-Salina; Lucy Kollhoff, Kansas State Univerty; Michael Kollhoff, Salina South High School

Tagged Divisions

Engineering Technology

introductory course a part of their proposed STEM pathway.Qualified high school students will also be able to pick other existing four-year collegeSTEM offerings as concurrent credit or dual credit.The STEM course (or its adapted form) can be used to facilitate a three-tiered articulationthat also involves two-year programs (Fig. 1). With two-year programs, the problem liesin the inherent difficulty of determining university course equivalency for AAS technicalcourses; a dilemma not characteristic of Associate of Arts (AA) transfer initiatives. Whentransferring to a four-year program, direct equivalency is not always possible due toregulatory requirements; while our immediate focus is on the STEM course, in anoutcome-based culture, it should be

Conference Session

Engaging Students

Collection

2010 Annual Conference & Exposition

Authors

Junko Munakata-Marr, Colorado School of Mines; Jennifer Schneider, Colorado School of Mines; Barbara Moskal, Colorado School of Mines; Carl Mitcham, Colorado School of Mines; Jon Leydens, Colorado School of Mines

Tagged Divisions

Environmental Engineering

engineering students often failto appreciate critical interrelations between technical and nontechnical aspects of sanitation. Toaddress this deficiency, a case-study module on sanitation for the developing world wasimplemented in a senior/graduate level onsite water reclamation course. The goal was to increasestudent awareness of the interplay between technical and nontechnical complexities whendesigning and implementing sanitation systems in both the developed and developing world.Learning objectives included increasing student familiarity with (1) perceptions and treatmentoptions of sanitary waste in developing countries and (2) nontechnical constraints and issues(such as economic, social, cultural, political, and ethical) associated with

Conference Session

Enhancing K-12 STEM Education with Engineering

Collection

2010 Annual Conference & Exposition

Authors

Steve Macho, Buffalo State College

Tagged Divisions

K-12 & Pre-College Engineering

several successful Engineering Technology programs and a TechnologyEducation program within our department. In 2007, faculty these programs workedtogether to provide engineering education professional development experiences fornearly 400 teachers; who in turn have taught thousands of K-12 students. This wasfacilitated with the assistance of a $1.7 million grant, and visiting faculty from severalleading design centers in England. This conceptual framework is partially a result of thefindings of that project. Within our Technology Education program, this is ourframework for preparing technology teachers. These teachers promote technologicalliteracy and engineering. The four elements of the framework are 1) Design, 2) Living, 3) Productivity

Conference Session

Faculty & Program Exchanges: Internationalizing, Collaborations, Interactions

Collection

2010 Annual Conference & Exposition

Authors

Vinod Lohani, Virginia Tech; Ricky Castles, Virginia Tech; Gary Riggins, Virginia Tech

Tagged Divisions

International

  The culture of education [0] [1]. Bruner proposed that a learning curriculum could be arranged sothat the central questions, or themes in a discipline, would be returned to again and again aslearners advance in their knowledge and intellectual capacity. A 7-step process is developed toimplement the spiral curriculum in the bioprocess engineering and details are presented in [2]and [3]. All workshop participants were introduced to the spiral curriculum process adopted bythe DLR project investigators in reformulating the curriculum of the bioprocess engineering. TheDLR project investigators have conducted spiral curriculum workshops at national andinternational sites [2]. In addition, a number of hands-on engineering learning activities

Conference Session

Design in BME Education

Collection

2010 Annual Conference & Exposition

Authors

Eric Kennedy, Bucknell University; Donna Ebenstein, Bucknell University

Tagged Divisions

Biomedical

conventionalmachining [1]. These skills are vital for engineers to communicate design ideas, and a basicunderstanding of manufacturing technology helps enable students to consider how a design onpaper might be turned into a physical prototype. Faculty observations and student and alumnifeedback have indicated that these skills are vital for success in classroom design projects suchas senior design, as well as for careers in industry [2]. Page 15.482.2Within the biomedical engineering curriculum at Bucknell University, a fabrication andexperimental design course is integrated into a four course design sequence where two coursescomprise the senior capstone

Conference Session

Engineering Technology Progress Reports: Part I

Collection

2010 Annual Conference & Exposition

Authors

Kenneth Stier, Illinois State University

Tagged Divisions

Engineering Technology

ABET. The focus ofthis transition was on developing effective and sustainable assessment model that would positionthe program for meeting TAC ABET Accreditation requirements. Also presented are examplesof the templates developed for outcomes assessment and a description of the process theEngineering Technology faculty went through to adopt this current assessment plan.Moving the Existing Program to Outcomes-Oriented TC2K CriteriaThe original assessment model that had been used for previous accreditation reviews wasdeveloped based on MU’s Board of Higher Education recommendations and following themodels suggested by Sarapin11 and Strong et al12. The following was MU’s engineeringtechnology assessment model:Step 1 – Develop a mission

Conference Session

Attracting Young MINDS in Engineering - Part II

Collection

2010 Annual Conference & Exposition

Authors

Lauren Thomas, Virginia Tech; Michael Smith, National Society of Black Engineers

Tagged Divisions

Minorities in Engineering

without a similar background a greater motivation to continue their own technical developmentPrior research and outreachThe research objectives of the TORCH program also rely heavily on four primary categories ofprior research: (1) engineering outreach models for females (2) engineering education outreachprograms and practices (3) the lack of formal K-12 engineering education and (4) persistence,mentoring and goal alignment. Again, the differences of program assessment and research areduly noted, however much of the literature is assessment in nature. We still refer to thesepublications as a baseline for developing the program and the research agenda.Engineering outreach models for femalesIn recent years several organizations, universities

Conference Session

Computer Education Innovations I

Collection

2010 Annual Conference & Exposition

Authors

David Ahlgren, Trinity College; Igor Verner, Technion-Israel Institute of Technology

Tagged Divisions

Computers in Education

persons with severe disabilities is increasing and will continue to grow as the population ages[1]. Many persons with disabilities benefit from an assistive technology device, an “item, pieceof equipment, product or system, whether acquired commercially off the shelf, modified, orcustomized, that is used to increase, maintain, or improve the functional capabilities of personswith disabilities. “[2]. In a 2005 survey by the U.S. Department of Education, National Instituteon Disability and Rehabilitation Research, 64% of respondents used some assistive technology.The most frequently used were devices that enhance mobility (canes, crutches, walkers, scootersand wheelchairs), hearing aids, and oxygen tanks. Most respondents who used AT said it

Conference Session

Teaching Technological Literacy - College Courses and Minors

Collection

2010 Annual Conference & Exposition

Authors

Richard Doyle, Penn State University; Richard Devon, Pennsylvania State University

Tagged Divisions

Technological Literacy Constituent Committee

our lives, from enabling citizens to perform Page 15.1184.2 routine tasks to requiring that they be able to make responsible, informed decisions that affect individuals, our society, and the environment. Citizens of today must have a basic understanding of how technology affects their world and how they exist both within and around technology.”6While persuasive in general, there are many caveats to these propositions:1. It is not possible to be literate about all, or even most, technologies. For example, doctors,electrical engineers, material scientists, biotechnologists, and chemical engineers, typically livein mutually

Conference Session

Enhancing CE Learning Through Use of Technology

Collection

2010 Annual Conference & Exposition

Authors

Monique Head, Texas A&M University

Tagged Divisions

Civil Engineering

responses.Why Use Clickers?The use of clickers or Classroom Performance System (CPS) devices is not a new application oftechnology. Previous studies have shown the effectiveness of the clicker technology to revealingconcept retention and evaluating short-term retention.1-3 However, the manner in which they canbe used is vast and may be seemingly appropriate for some engineering courses to stimulate thelearning environment and provide real-time assessment for both the students and instructor.Students can respond to multiple choice, yes/no, Likert scale, and true/false questions along withproviding numeric responses and even responses to questions posed "on the fly" by theinstructor. The CPS software enables the instructor to display the questions via

Conference Session

Tricks of the Trade in Teaching II

Collection

2010 Annual Conference & Exposition

Authors

Rungun Nathan, Pennsylvania State University, Berks

Tagged Divisions

New Engineering Educators

isabout “Fill-in Worksheets”, a tool that was developed to increase student engagement inclassroom and allows for incorporating PBL, AL and CL along with Peer Instruction (PI).The paper describes the steps and thought process that was used in developing the fill-inworksheets over the past several years. The worksheets have enabled the author toincrease student engagement, include AL, CL and implement PI in the classroom.Introduction“Educators, researchers and policy makers have advocated student involvement forsometime as an essential aspect of meaningful learning.”1 To engage students, educatorshave used techniques like active2 and cooperative learning3, 4, inquiry and problem basedlearning, team projects, service learning and undergraduate

Conference Session

Sustainable Energy Education

Collection

2010 Annual Conference & Exposition

Authors

Connie Gomez, University of Texas at El Paso; Heidi Taboada, University of Texas at El Paso; Jose Espiritu, University of Texas at El Paso; Noe Vargas Hernandez, The University of Texas at El Paso

Tagged Divisions

Energy Conversion and Conservation

. Moreover,increasing numbers of manufacturers are beginning to evaluate their products and even theirproduct packaging for sustainability, whether to meet mandatory retail initiatives or to reap someof the rewards associated with greater environmental stewardship. This shift in product designmeans that engineering education needs to produce engineers that can provide technologicalinnovation while protecting the environment. These demands also mean that universities acrossthe nation need to build bridges between undergraduate engineering education and sustainabilityengineering in both research and industry.1 This paper describes an approach to includesustainability engineering within an existing engineering program through 1) curriculumdevelopment

Conference Session

Enhancing K-12 STEM Education with Engineering

Collection

2010 Annual Conference & Exposition

Authors

Taylor Martin, University of Texas, Austin; Tom Benton, University of Texas, Austin; William McKenna, University of Texas, Austin; Pat Ko, University of Texas at Austin

Tagged Divisions

K-12 & Pre-College Engineering

$&75$16)(52)$'$37,9((;3(57,6(7275$16)250(1*,1((5,1*('8&$7,217D\ORU0DUWLQ8QLYHUVLW\RI7H[DV$XVWLQ 7D\ORU0DUWLQUHFHLYHGD%$LQ/LQJXLVWLFVDQGDQLQLWLDOWHDFKLQJFHUWLILFDWLRQIURP'DUWPRXWK &ROOHJHLQDQ06LQ3V\FKRORJ\IURP9DQGHUELOW8QLYHUVLW\LQDQGD3K'LQ (GXFDWLRQIURP6WDQIRUG8QLYHUVLW\LQ6KHMRLQHGWKHIDFXOW\DWWKH8QLYHUVLW\RI7H[DVDW $XVWLQLQ+HUSULPDU\UHVHDUFKLQWHUHVWLVKRZSHRSOHOHDUQFRQWHQWLQFRPSOH[GRPDLQV IURPDFWLYHSDUWLFLSDWLRQERWKSK\VLFDODQGVRFLDO6KHLVFRRSHUDWLQJZLWKORFDOHOHPHQWDU\ VFKRROVWRLPSURYHDVVHVVPHQWWRROVIRU\RXQJFKLOGUHQVPDWKHPDWLFVDQGWRH[DPLQHKRZ KDQGVRQDFWLYLWLHVLPSDFWPDWKHPDWLFVOHDUQLQJDQGLQYHVWLJDWLQJWKHGHYHORSPHQWRIDGDSWLYH H[SHUWLVHWKURXJKFRRSHUDWLRQZLWKWKH9D17

Conference Session

NSF Grantees Poster Session

Collection

2010 Annual Conference & Exposition

Authors

Tzu-Liang Tseng, University of Texas, El Paso; Ryan Wicker, UTEP; Rong Pan, Arizona State University; Carolyn Awalt, The University of Texas at El Paso

. Awalt teaches online courses in curriculum theory, videoconferences weekly for her educational technology classes, and teaches instructional design classes at Fort Bliss. Dr. Awalt has worked with El Paso Independent School District as a technology professional developer and as a program evaluator. She coauthored a Transition to Teaching Grant for the Department of Education for almost $1 million, and a Hewlett Packard grant to expand the use of table PCs and study the impacts of mobile technology resources on Engineering and Education students at UTEP. Page 15.504.1© American Society for

Conference Session

Retention Strategies in Action Part II

Collection

2010 Annual Conference & Exposition

Authors

Sheryl Custer, Texas A&M University, Kingsville; Harriet Lamm, Texas A&M University-Kingsville; David Ramirez, Texas A&M University; Kuruvilla John, University of North Texas

Tagged Divisions

Two Year College Division

memorandum of understanding was obtained from each institution acknowledgingtheir participation in the TAMUK’s STEP project. The project’s internal evaluator collects andprocesses the TAMUK transfer data for the partnering institutions, assesses project data, andprepares reports for the project’s sponsor and for dissemination.Purpose There are three main objectives that the STEP program addresses. Objective 1 targets thenumber of community college SEM transfers. Objective 2 focuses on the enhancement ofstudent success. Objective 3 concentrates on improving persistence to degree completion for thepredominantly first generation and Hispanic students of South Texas. While all three objectivesare vital to the project, this paper discusses only

Conference Session

Innovative Pedagogies for Teaching Introductory Materials

Collection

2010 Annual Conference & Exposition

Authors

Stephen Krause, Arizona State University; Elliot Douglas, University of Florida; Cindy Waters, North Carolina A&T State University; Michael Prince, Bucknell University; Trevor Harding, California Polytechnic State University

Tagged Divisions

Materials

increasing frequency as a means to engagestudents in their own learning. The use of active learning in the classroom spans a continuum,ranging from the occasional use of problems for students to solve, to the extensive use ofdiscussions, problems, or other activities in a class. Guided inquiry falls at the extreme end ofthis continuum. In a traditional class, students acquire knowledge by coming to the classroom,listening to instructors’ lectures, and taking notes. In a guided inquiry class, the instructor doesnot lecture. Rather students work in teams, typically of four students, to complete worksheets.The worksheets contain three components: 1) Data or information as background material; 2)Critical thinking questions, which are designed to lead

Conference Session

Assessment & Continuous Improvement in ET: Part III

Collection

2010 Annual Conference & Exposition

Authors

Virginia Westheider, University of Cincinnati; Sarai Hedges, University of Cincinnati

Tagged Divisions

Engineering Technology

instruments andchanging the administration of two of them. The final measure of the project’s success willoccur after programs have reviewed the results and made changes needed and have completedthe assessment loop prior to the next ABET accreditation visit in 2013. An intermediate measurewill include reports of the improvements and changes made annually as the data is collected andreviewed and the plan updated.HistorySix Sigma, started in 1986 by Motorola, has been defined in numerous ways. It has been called aphilosophy, a methodology, and a set of tools.1 One of the more concise definitions is “adisciplined, data-driven approach and methodology for eliminating defects … in any process --from manufacturing to transactional and from product to

Conference Session

NSF Grantees Poster Session

Collection

2010 Annual Conference & Exposition

Authors

Kingsley Reeves, University of South Florida; Susana Lai-Yuen, University of South Florida

and hands-on sessionsfocused on the medical device project to help students through the learning process and therealization of their projects. Project assessment included the expert opinion of local industrypractitioners who interacted directly with the students. Analysis of the results of this approach ispresented. This paper focuses on preliminary results relevant to the New Product Developmentcourse.1. IntroductionThe medical device and equipment industry is one of the fastest growing industries in the world.The U.S. is the largest medical device market and is the global leader of the medical device andtechnology industry. Medical devices are important for the diagnosis, monitoring, and treatmentof disease, and for the compensation for an

Conference Session

Energy Education and Industry Needs

Collection

2010 Annual Conference & Exposition

Authors

Darrell Wallace, Youngstown State University; Brian Vuksanovich, Youngstown State University; Michael Costarell, Youngstown State University

Tagged Divisions

Energy Conversion and Conservation

were made and the magnitude of theirimpact on overall system performance.A significant cost of operation for this manufacturing facility is related to cooling finishedproduct. Hot jars of pasta sauce pass through a cooling tunnel where they are showered withcool water. Heat from the jars is transferred to the cooling water and subsequently extractedfrom the water through a heat exchanger and mechanical chilling system. A conventional systemconfiguration is shown in Figure 1. Major energy consumers in the process are the pumpingrequired to shower the jars with thousands of gallons of water per minute and the refrigerationsystem required to chill the cooling water

Conference Session

Modeling Student Data

Collection

2010 Annual Conference & Exposition

Authors

Michael Dyrenfurth, Purdue University; Mike Murphy, Dublin Institute of Technology; Gary Bertoline, Purdue University

Tagged Divisions

Educational Research and Methods

engineering or technologyprograms, but rather of the university.Introduction & MethodologyToday's world, and by all indicators the world of the future, seems to be increasingly competitive[1] and demanding. Resource scarcity, an increasing imperative for efficiency and effectiveness,manifestly more available information and escalating expectations for quality are but some of thefactors that have caused universities, colleges, departments and programs to attend to evaluation,accreditation and invariably rankings and comparisons [2, 3]. Furthermore, increased global andintra-national mobility as well as widespread access to information has created the opportunityfor individuals to more carefully research their selection of universities to attend

Conference Session

Multidisciplinary Engineering Technology Courses

Collection

2010 Annual Conference & Exposition

Authors

David Cottrell, University of North Carolina, Charlotte

Tagged Divisions

Engineering Technology

arepresented below: Table 1: Assessment results for effectively functioning on a team Assessment Results Target 2005 2006 2007 2008 2009 2009 (Fall) (Fall) (Fall) (Fall) (Spring) (Fall) 80% 77% 84% 73% 100% 100% 74.1%Assessment of the data clearly indicates the variability of this measure. Previous discussionsamong the faculty recommended sustainment of peer evaluations as an effective protocol forassessing student participation and group work. However, it was recommended that thecurriculum be modified to provide instruction directly on group dynamics and the

Conference Session

Technological Literacy for K-12 and for Community College Students: Concepts, Assessment, and Courses

Collection

2010 Annual Conference & Exposition

Authors

Randy Libros, Community College of Philadelphia; Kathleen Harter, Community College of Philadelphia

Tagged Divisions

Technological Literacy Constituent Committee

issued are addressed depends upon the context of the institution.We will examine four factors at Community College of Philadelphia that were important in thedevelopment of this course: 1. Establishment of a new curriculum in Applied Science and Engineering Technology (ASET) 2. General Education Requirements 3. Transferability 4. Developmental EducationThe emphasis of the Applied Science and Engineering Technology (ASET) Program is to enablestudents to enter the workforce on the technician level in high technology, high demandemployment areas. The program has a very flexible design to enable rapid response to changingtechnological, workforce, and student needs. Courses leading to an Associate in Applied Sciencein the ASET program

Conference Session

New Instrumentation Ideas

Collection

2010 Annual Conference & Exposition

Authors

Abhijit Nagchaudhuri, University of Maryland, Eastern Shore; Madhumi Mitra, University of Maryland, Eastern Shore; Xavier Henry, University of Maryland, Eastern Shore; Dayvon Green, Morgan State University

Tagged Divisions

Instrumentation

engineeringmajors respectively,. This paper highlights the summer efforts and the subsequent studentlearning experiences during the fall semester involving this experimental platform. Futureeducational and research efforts to develop and use an autonomous water quality data collectionsystem for lakes, rivers, and bays are underway.1.0 IntroductionThe problem of water eutrophication has become very severe worldwide. The nutritive organicwastes resulting from land runoff, river inflow, or sewage discharged into the coastal areas withlow rates of water exchange often could lead to proliferation of the growth of excessive amountsof both micro and macroalgae.1 The water body impacted is termed “eutrophic” (nutrient

Conference Session

Design Projects in Mechanical Engineering II

Collection

2010 Annual Conference & Exposition

Authors

Brian Vuksanovich, Youngstown State University; Darrell Wallace, Youngstown State University

Tagged Divisions

Mechanical Engineering

-produce the worldduring WWII. Innovation put us on the moon and fueled the computer and internet boom of the1990’s. Studies going back as far as 1959 have identified engineering creativity as a vitalcontributor to industry competitiveness and the national welfare. 1 A preponderance of literaturepublished in the past five years points to a lack of soft skills, including creative innovation, asfactors in declining global competitiveness. 2,3,4,5 At the root of this problem is a deeplyentrenched educational paradigm that does not encourage creative thinkers.This innovation was possible because there were people that not only understood engineeringprinciples; they also knew how to apply them in ways that satisfied a human need. Theseengineers were

Conference Session

New Instrumentation Ideas

Collection

2010 Annual Conference & Exposition

Authors

Randy Buchanan, University of Southern Mississippi; Steven Bunkley, University of Southern Mississippi

Tagged Divisions

Instrumentation

support.By this time, the interested faculty and student had already identified the needed apparatus andmethodologies. Existing instrumentation was identified to perform the task, as well as a minimalamount of budget reserves to purchase ancillary items. The test apparatus design was modified tofit the existing instrumentation and available resources.Test ApparatusThe apparatus used was designed to utilize gravitational acceleration for consistent andrepeatable results. Several differing configurations were considered throughout the design andeven construction process. The final arrangement made use of two angle bars as guides for asolid rectangular mass, as shown in Figure 1. The mass can be freely lifted vertically along theguide rails to max

Conference Session

Computational Tools and Simulation II

Collection

2010 Annual Conference & Exposition

Authors

Richard Stanley, Kettering University; Timothy Cameron, Kettering University

Tagged Divisions

Computers in Education

. Student surveys and the results of student assignments suggest that theparametric studies enhanced the students’ overall comprehension of dynamics.1. IntroductionIn typical Dynamics courses, most homework problems require the student to solve for agiven variable at an instant in space and time. The professor typically assigns a set ofhomework problems and the students solve each problem by hand. The student knowsthat his or her calculations are correct by checking answers in the back of the book.In reality, the subject of particle Dynamics is the study of motion and not the calculationof a particle’s point at a particular instance in time. This differentiation is probably lost inthe traditional classroom. A unique web-based animation program has