Collection

2022 ASEE Midwest Section Conference

Authors

Thomas McKean; Jorge Almodovar; Aubrey Schultz; Natacha S. Melgar; S. Ranil Wickramasinghe

2022 ASEE Midwest Section Conference Undergraduate Research and Mentoring in Separations Thomas McKean, Jorge Almodovar, Aubrey Schultz, Natacha Souto Melgar, S. Ranil Wickramasinghe Ralph E Martin Department of Chemical Engineering, University of Arkansas, Fayetteville, AR 72703AbstractA Research Experiences and Mentoring (REM) program was developed to provide summerresearch and mentoring opportunities to underrepresented minority community college students.It was the goal of the program to introduce underrepresented minority community college studentsto STEM research opportunities they are not

Collection

2018 Gulf Southwest Section Conference

Authors

S. Nasrazadani; S. Sekar; N. Padamati; X. Wang; F. Gamez-Rivas

Training Graduate Students in Utilization of Analytical Instruments in a Failure Analysis Course S. Nasrazadani, S. Sekar, N. Padamati, X. Wang, F. Gamez-Rivas Department of Engineering Technology University of North Texas Denton, Texas 76207, E-mail: seifollah.nasrazadani@unt.edu Abstract Technology at University of North Texas offers a sequence Department of Engineering Technology at University of of graduate course one on Failure Analysis in the FallNorth Texas offers a

Collection

2007 Spring ASEE Middle Atlantic Section Conference

Authors

L. Kuczynski; C. McGuinness; S. Farrell; B. G. Lefebvre; C. S. Slater

Sponsored Industrial Research Experiences for Undergraduate Students: Student Perspectives on Collaborative Projects with Pharmaceutical Industry L. Kuczynski, C. McGuinness, S. Farrell, B. G. Lefebvre, and C. S. Slater Rowan University Chemical Engineering 201 Mullica Hill Rd. Glassboro, NJ 08028-1701 USAAbstract Rowan University’s Engineering program uses innovative methods of teaching and learningto prepare students better for a rapidly changing and highly competitive marketplace, asrecommended by ABET1. Rowan has developed a program that fosters synergistic

Conference Session

Gamification

Collection

ASEE Southeast Section Conference

Authors

Leigh S McCue, George Mason University

Tagged Topics

Professional Engineering Education Papers

Paper ID #36530A Pandemic Pivot PodcastDr. Leigh S McCue, George Mason University Leigh McCue is an Associate Professor and Chair of George Mason University’s Department of Mechan- ical Engineering. ©American Society for Engineering Education, 2023 2023 ASEE Southeastern Section Conference A Pandemic Pivot Podcast Leigh McCue George Mason UniversityAbstractIn mid-2021, with COVID-19 restrictions persisting in preventing face-to-face outreach activities,Mason’s Department of

Conference Session

Design in Engineering Education Division (DEED) Poster Session

Collection

2023 ASEE Annual Conference & Exposition

Authors

Kyung S Kang, Marian University

Tagged Divisions

Design in Engineering Education Division (DEED)

Paper ID #38924Board 75: Work-in-Progress: Instructor and Student Reflections onFirst-year Engineering DesignDr. Kyung S Kang, Marian University Kyung Kang has served as an assistant professor of mechanical engineering at Marian University since 2022. ©American Society for Engineering Education, 2023 Work-In-Progress: Instructor and Student Reflections on First-year Engineering DesignAbstractThis work-in-progress paper summarizes how engineering faculty tried to make the betterlearning environment for the first-year engineering students by minimizing instructorinvolvement. In the

Conference Session

Work-in-Progress Session: Emergent Methods for Engineering Education Research

Collection

2023 ASEE Annual Conference & Exposition

Authors

Trevion S Henderson, Tufts University

Tagged Divisions

Educational Research and Methods Division (ERM)

Paper ID #40058Work in Progress: Research on Engineering Students’ EpistemologicalBeliefs in Design Decision Making; Conceptual Issues and a NewMethodological ApproachDr. Trevion S Henderson, Tufts University Trevion Henderson is Assistant Professor of Mechanical Engineering at Tufts University. He earned his Ph.D. in Higher Education at the University of Michigan. ©American Society for Engineering Education, 2023 (WIP) Research on Engineering Students’ Epistemological Beliefs in Design Decision Making: Conceptual Issues and a New Methodological ApproachThis work-in-progress paper reports on an

Collection

2005 GSW

Authors

Yavuz S. Tunc; Malur N. Srinivasan

Session Number: F2D2 Teaching Mechanical Engineering Undergraduates about Nanomaterials Malur N. Srinivasan and Yavuz S. Tunc Department of Mechanical Engineering Lamar University, Beaumont, TX 77710 ABSTRACTNanomaterials have attracted enormous attention in the recent years. They have small featuresize (crystallite size) in the range of 1-100 nm and are structurally quite distinct from traditionalcrystalline materials whose feature size may extend from several micrometers to severalmillimeters, and traditional amorphous materials, which

Conference Session

Pre-College Engineering Education Division Technical Session 15

Collection

2021 ASEE Virtual Annual Conference Content Access

Authors

Stacy S. Klein-Gardner, Vanderbilt University

Tagged Divisions

Pre-College Engineering Education

Paper ID #32523Elementary Students Learn How To Engineer Online (RTP)Dr. Stacy S. Klein-Gardner, Vanderbilt University Stacy Klein-Gardner’s career in P-12 STEM education focuses on increasing interest in and participation by females and URMs and on teacher professional development. She is an Adjunct Professor of Biomedi- cal Engineering at Vanderbilt University where she serves as the co-PI and co-Director of the NSF-funded Engineering For US All (e4usa) project. Dr. Klein-Gardner formerly served as the chair of the American Society for Engineering Education (ASEE) Board of Directors’ P12 Commission and the Pre-College

Collection

2010 North Midwest Section

Authors

Eric S. Musselman; Andrea J. Schokker

Constructing a Civil Engineering Program from the Ground Up Eric S. Musselmana, PhD, PE; Andrea J. Schokkerb, PhD, LEED AP a Assistant Professor, University of Minnesota Duluth, Duluth MN 55812 b Professor and Department Head, University of Minnesota Duluth, Duluth MN 55812AbstractThis paper discusses the development and continuing refinement of the curriculum for the newCivil Engineering Program at the University of Minnesota Duluth. Included is a discussion ofthe program objectives, curriculum development, and integration of assessment into thecurriculum.IntroductionThe University of Minnesota Duluth (UMD) is a comprehensive regional university located inDuluth, MN. There is an active student

Collection

2011 North Midwest Section

Authors

M. S. Stachowicz; L. B. Kofoed

Problem Based Learning Principles for projects with “soft” evaluation. 1 M. S. Stachowicz, 2L. B. Kofoed Laboratory for Intelligent Systems, Department of Electrical and Computer Engineering, University of Minnesota, USA, The Warsaw School of Computer Science, Warsaw, Poland mstachow@d.umn.edu1 Department of Architecture, Design & Media Technology, Aalborg University, Denmark, lk@create.aau.dk2IntroductionInspired by a design workshop course offered at the Electrical and Computer Engineering Department(ECE) at the University of Minnesota Duluth (UMD) [1] we could see

Conference Session

Mechanical Engineering Technical Session: Outreach and Retention

Collection

2020 ASEE Virtual Annual Conference Content Access

Authors

Leigh S. McCue, George Mason University

Tagged Topics

Diversity

Tagged Divisions

Mechanical Engineering

Paper ID #28588The Portia Hypothesis: Mechanical Engineering Student Perceptions ofQualificationsDr. Leigh S McCue, George Mason University Leigh McCue is an Associate Professor in George Mason University’s Department of Mechanical Engi- neering. Dr. McCue received her BSE degree in Mechanical and Aerospace Engineering in 2000 from Princeton University. She earned her graduate degrees from the University of Michigan in Aerospace Engineering (MSE 2001) and Naval Architecture and Marine Engineering (MSE 2002, PhD 2004). American c Society for Engineering Education, 2020

Collection

2021 ASEE Midwest Section Conference

Authors

Mahmood Jebur; S. Ranil Wickramansinghe

2021 ASEE Midwest Section Conference Design of an Integrated Electrocoagulation-Microfiltration System for Community College Laboratory Experiments Mahmood Jebura, S. Ranil Wickramasinghea a Ralph E Martin Department of Chemical Engineering, University of Arkansas, Fayetteville, AR 72701, United StatesAbstractIn collaboration with faculty at NorthWest Arkansas Community College (NWACC) anintegrated electrocoagulation-microfiltration (EC-MF) system was designed for use in laboratoryexperiments as a part of a National Science Foundation Research Experiences for Teachers(RET) program. Here

Collection

2013 North Midwest Section Meeting

Authors

Dilpreet S. Bajwa; Sreekala G. Bajwa

ASEE-NMWSC2013-0058 Industry and Students Perception of Capstone ProjectsDilpreet S Bajwa, Department of Mechanical Engineering and Sreekala G Bajwa, Agriculturaland Biosystems Engineering, North Dakota State University, Fargo, ND.Email – dilpreet.bajwa@ndsu.edu , sreekala.bajwa@ndsu.eduAbstractCapstone projects are designed to help students learn technical, communication and interpersonalskills that will ultimately provide them with a broad knowledge base required at the start of theirprofessional careers. Engineering capstone experience prepares students to work in a productivemanner in teams. It is expected that the students will learn problems solving

Conference Session

Innovations in Mechanical Engineering Education Poster Session

Collection

2007 Annual Conference & Exposition

Authors

S. Perwez Kalim, Wilkes University

Tagged Divisions

Mechanical Engineering

AC 2007-558: IMPROVING RETENTION BY IMPLEMENTING OUTCOMEBASED DESIGN EXPERIENCE IN A SOPHOMORE COURSES. Perwez Kalim, Wilkes University S. Perwez Kalim Associate Professor of Mechanical Engineering Wilkes University, Wilkes Barre, PA 18766 Page 12.859.1© American Society for Engineering Education, 2007 Improving Retention by Implementing Outcome Based Design Experience in a Sophomore CourseABSTRACT The student retention in the private institutions is, in general, a difficult problem tohandle and even more difficult to manage in the engineering programs. This study reports howthe

Collection

2021 Fall ASEE Middle Atlantic Section Meeting

Authors

Thomas S. Soerens, Messiah University

Paper ID #35666Peer teaching research group model for upper level environmentalengineering class with student-led lectures and journal articlediscussionsDr. Thomas S. Soerens, Messiah University Thomas Soerens is Professor of Engineering at Messiah University. He teaches in Civil and Environmental engineering with specialization in storm water, ground water, and water treatment. He performs design and applied research in water systems in rural developing communities. He is a Professional Engineer and a Certified Ecological Designer. American c Society for Engineering

Collection

2003 GSW

Authors

Kuldeep S. Rawat; Gholam H. Massiha

Designing Telemetric Data Acquisition System For Clinical Studies Kuldeep S. Rawat, and Gholam H. Massiha Department of Industrial Technology University of Louisiana at Lafayette AbstractThis paper presents a systematic approach to design a PC-based telemetric data acquisitionsystem for clinical studies. This involves understanding signal characteristics, signal pick-updevices, mechanism to transfer signal telemetrically, and other data acquisition hardwarecomponents. Most of the clinical studies involve capturing and processing biological signals likecough, sneeze, snore, and pain. A PC

Collection

2003 GSW

Authors

Kuldeep S. Rawat; Sumit R. Pal

Application of Signal Processing Tools in the Interpretation of Geophysical Seismic Data Kuldeep S. Rawat Center for Advanced Computer Studies University of Louisiana at Lafayette Sumit R. Pal Superior Energy Services LLC, Broussard, LA Energy Institute, University of Louisiana at Lafayette, LA AbstractExpensive to acquire and almost impossible to re-acquire, seismic reflection andrefraction data sets are no doubt the most important assets of any hydrocarbonexploration and prospecting program. During exploration, seismic

Collection

2003 GSW

Authors

Alfred J. Jayachandran; Edward S. Kolesar

Design and Operation of a MEMS Microengine Fabricated from Asymmetrical Polysilicon Surface Micromachined Electrothermal Microactuators Alfred J. Jayachandran and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA e-mail: e.kolesar@tcu.edu*Faculty Research Mentor AbstractSeveral electrically-driven microactuators have been

Collection

2003 GSW

Authors

William E. Odom; Edward S. Kolesar

Characterization of Symmetrical and Asymmetrical Polysilicon Surface Micromachined Electrothermal Actuators William E. Odom and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA PH: 817-257-6226 FAX: 817-257-7704 e-mail: e.kolesar@tcu.edu*Faculty Research Mentor AbstractSeveral electrically-driven microactuators have been

Collection

2003 GSW

Authors

Kuldeep S. Rawat; Gholam H. Massiha

Model Driven Robot Simulation: RoboCell Kuldeep S. Rawat, and Gholam H. Massiha Department of Industrial Technology University of Louisiana at Lafayette AbstractRobotics courses are offered in the College of Engineering at University of Louisiana atLafayette. Subjects such as robot applications, end of arm tooling, safety, and analysis of robotspecifications are covered in these courses. These robotics fields have benefited considerably inthe last three decades from the advancement of computer science, as advanced software toolswere developed to study the working of robots. As robots have

Collection

2003 GSW

Authors

Edward S. Kolesar; Matthew D. Ruff

Three-Dimensional Microelectromechanical Systems (MEMS) Structures Assembled from Polysilicon Surface Micromachined Elements Containing Continuous Hinges and Microrivets Matthew D. Ruff and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA PH: 817-257-6226 FAX: 817-257-7704 e-mail: e.kolesar@tcu.edu*Faculty Research Mentor

Collection

1996 Annual Conference

Authors

Paul S. Chinowsky; Jorge A. Vanegas

Session 1221 Combining Practice and Theory in Construction Education Curricula Paul S. Chinowsky and Jorge A. Vanegas Georgia Institute of TechnologyAbstract The development of construction education curricula has undergone several significant changes overthe last several decades. Existing construction programs fall primarily under two categories, constructionengineering and construction management programs. Further, construction education is significantlydifferent at the undergraduate and graduate levels and within engineering and non-engineering

Collection

1996 Annual Conference

Authors

John S. Gillard; Gary P. Maul

Session 3557 Teaching The Tools of Quality Gary P. Maul John S. Gillard The Ohio State University Honda of America Manufacturing Columbus, OH Marysville, OHIntroduction Total Quality Management (TQM) is not the panacea it might have promised to be. However, the tools ofquality used in TQM are of considerable value. Used correctly they can be used to resolve many businessconcerns. Correct use comes from teaching not only the tools

Collection

1996 Annual Conference

Authors

Nelson C. Baker; Paul S. Chinowsky

Session 3515 Technology in the Civil Engineering Classroom: Introduction and Assessment Nelson C. Baker1, Paul S. Chinowsky2 Georgia Institute of Technology Abstract The introduction of innovative technologies into the civil engineering classroom is providingunprecedented opportunities to examine traditional educational methodologies. The development of video,multimedia, and advanced computer modelling technologies provides educators with the tools to divergefrom the static arena of

Collection

1997 Annual Conference

Authors

Dean R. Johnson; S. Hossein Mousavinezhad

Session 3532 ALGORITHMS AND COMPUTER METHODS IN DIGITAL SIGNAL PROCESSING S. Hossein Mousavinezhad, Professor & Chairperson, and Dean R. Johnson, Associate Professor Department of Electrical and Computer Engineering Western Michigan University Kalamazoo, Michigan h.mousavinezhad@wmich.edu dean.johnson@wmich.edu (616) 387-4057 FAX (616) 387-4024 I. INTRODUCTIONDigital Signal Processing

Collection

1997 Annual Conference

Authors

Chandra S. Brahma; Howard C. Biddlecome

''ZECXCVKQPTGOQXGUCOCUUQHUQKNCPFYCVGTRTQFWEKPICTGFWEVKQPQHVQVCNUVTGUUCVVJGDQVVQOQHVJGEWV6JGUQKNQWVUKFGVJGYCNNUCEVUNKMGCUWTEJCTIGCPFECWUGUVJGUQHVVQOGFKWOUQKNDGNQYVJGDQVVQOQHGZECXCVKQPVQOQXGWRYCTFWPNGUUCTGNCVKXGN[UVKHHUQKNUVTCVWONKGUPGCTVJGDCUGQHVJGEWV5WEJOQXGOGPVUCUUQEKCVGFYKVJCFGGREWVOCFGKPUQHVUQKNUCTGRCTVKEWNCTN[NCTIG6JGTKUGQHVJGDCUGKUKPXCTKCDN[CEEQORCPKGFD[CPKPYCTFOQXGOGPVQHVJGUQKNDGNQYVJGGZECXCVKQP6JGDCUGHCKNWTGQHCPQRGPGZECXCVKQPKUQTFKPCTKN[CPCN[\GFWUKPIRTQEGFWTGUHQTHQWPFCVKQPUVCDKNKV[ $CUGHCKNWTGQEEWTUYJGPVJGUWTEJCTIGRTGUUWTG*SFWGVQVJGWPKHQTOUWTHCEGNQCFKPISCPFVJGYGKIJVQHVJGEQNWOPQHUQKNWPKVYGKIJVQHJGKIJV * CFLCEGPV VQ VJG GZECXCVKQP DGEQOGU GSWCN VQ VJG PGV DGCTKPI ECRCEKV[ QH VJG UQKNWPFGTN[KPIVJGDQVVQOQHGZECXCVKQP(KIWTG#EEQTFKPIN[VJGHCEVQTQHUCHGV[CICKPUVDCUGHCKNWTG(5DKUIKXGPD[ (5D0ED5W*S YJGTG0EDDGCTKPIECRCEKV[HCEVQT

Conference Session

Design Methods and Concepts

Collection

2006 Annual Conference & Exposition

Authors

S. Balachandran, University of Wisconsin-Platteville

Tagged Divisions

Design in Engineering Education

2006-84: TEACHING A WEB-BASED GRADUATE COURSE ON TAGUCHIMETHODSS. Balachandran, University of Wisconsin-Platteville Dr. S. Balachandran is a Prof. of Ind. Eng., at UW-Platteville. He owns the consulting firm Process Improvement and has served as a consultant to manufacturing companies, businesses, law firms and government agencies. His areas of interest are ergonomics, continuous process and quality improvement, design of experiments, facilities design, manufacturing system design and simulation. He received B.E. Degree with Honors in Mech. Eng. from the University of Madras, India in 1968, and received M.E. degree with Distinction in Aeronautical Eng. with specialization in rockets

Conference Session

Improving ME instructional laboratories

Collection

2006 Annual Conference & Exposition

Authors

S. Perwez Kalim, Wilkes University

Tagged Divisions

Mechanical Engineering

Conference Session

ECE Poster Session

Collection

2006 Annual Conference & Exposition

Authors

S. Hossein Mousavinezhad, Western Michigan University

Tagged Divisions

Electrical and Computer

2006-1241: ELECTRIC & MAGNETIC FIELDS, TRANSMISSION LINES FIRST?S. Hossein Mousavinezhad, Western Michigan University BIOGRAPHICAL INFORMATION Dr. Mousavinezhad is an active member of ASEE and IEEE having chaired sessions in national and regional conferences. He is IEEE Region 4 Educational Activities Chair and member of the ASEE North Central Section Executive Board. He was the ECE Program Chair of the 2002 ASEE Annual Conference, Montreal, Quebec, June 16-19 and 2003 ASEE ECE Division Chair. Professor Mousavinezhad received ASEE/NCS Distinguished Service Award, April 6, 2002, for significant and sustained leadership. In 1994 he received Zone II Outstanding Campus

Conference Session

Pre-College: Resource Exchange

Collection

2017 ASEE Annual Conference & Exposition

Authors

Pamela S. Lottero-Perdue, Towson University

Tagged Topics

Diversity

Tagged Divisions

Pre-College Engineering Education Division

Paper ID #18460The 2017 Best STEM Books (Resource Exchange)Dr. Pamela S. Lottero-Perdue, Towson University Pamela S. Lottero-Perdue, Ph.D., is Associate Professor of Science Education in the Department of Physics, Astronomy & Geosciences at Towson University. She has a bachelor’s degree in mechanical engineering, worked briefly as a process engineer, and taught high school physics and pre-engineering. She has taught engineering and science to children in multiple informal settings. As a pre-service teacher educator, she includes engineering in her elementary and early childhood science methods courses, and has