Asee peer logo
Displaying results 35941 - 35970 of 50114 in total
Conference Session
Teams and Teamwork in Design
Collection
2010 Annual Conference & Exposition
Authors
R. Keith Stanfill, University of Florida; Arif Mohsin, University of Florida; Oscar Crisalle, University of Florida; Suleyman Tufekci, University of Florida; Carl Crane, University of Florida
Tagged Divisions
Design in Engineering Education
AC 2010-2032: THE COACH'S GUIDE: BEST PRACTICES FORFACULTY-MENTORED MULTIDISCIPLINARY PRODUCT DESIGN TEAMSR. Keith Stanfill, University of FloridaArif Mohsin, University of FloridaOscar Crisalle, University of FloridaSuleyman Tufekci, University of FloridaCarl Crane, University of Florida Page 15.1213.1© American Society for Engineering Education, 2010 The Coach’s Guide: Best Practices for Faculty-mentored Multidisciplinary Product Design TeamsAbstractFaculty mentors, also known as coaches, have two overarching roles when mentoringindustrially sponsored capstone design projects: (1) ensure the team achieves the academic goalsof the course, and (2) keep
Conference Session
Measuring the Impacts of Project-Based Service Learning on Engineering Education
Collection
2010 Annual Conference & Exposition
Authors
Kurt Paterson, Michigan Technological University; Colleen O'Holleran, Engineers Without Borders-USA; Cathy Leslie, Engineers Without Borders
Tagged Divisions
International
, and ASCE chapters) and a Summit gathering a subset of these advisors.This paper will present some of the main findings from the survey, an overview of the Summitstructure, and preliminary findings from that meeting.2. Faculty SurveyThe survey focused on two main topics, service learning in engineering education, and aspects ofbeing an advisor. Nearly 100 responses were gathered; response rates among EWB-USAadvisors were much higher than those for ASME and ASCE, 30% versus 6%, suggesting generalinterest in the subject. Among respondents, nearly 40% of engineering colleges have servicelearning courses (Figure 1); most engineering faculty though admit to using an informaldefinition of service learning, so these courses may better be described as
Conference Session
Innovations in Civil Engineering Education II
Collection
2010 Annual Conference & Exposition
Authors
James Ledlie Klosky, United States Military Academy; Stephen Ressler, United States Military Academy; Mark DeRocchi
Tagged Divisions
Civil Engineering
distributed between men andwomen. Among the general population (all ages), the use of online social networking is highlyprevalent, with the core age group of interest to most engineering programs, persons 18 to 29years of age, showing particularly heavy usage (see Figure 1). It should be noted that the chartsshown in Figure 1 represent the percentage of internet users reporting the use of socialnetworking sites, rather than the percentage of total persons surveyed. It is thus clear that the useof social networking sites is very heavy among college students. (A casual survey of studentcomputer screens, as seen from the back of many darkened lecture halls, would as easily identifythis trend.)A major advantage of social networking sites is the “pull
Conference Session
College-Industry Partnerships: Bringing Industry into the Curriculum Development and Design Cycle
Collection
2010 Annual Conference & Exposition
Authors
Waddah Akili, Iowa State University
Tagged Divisions
College-Industry Partnerships
industry in theRegion.ReviewWhat does “design” mean in an engineering context? What are the qualifications of a designer?Can design be taught? And if so, who can teach it? These questions will be addressed in theparagraphs that follow.Relevant Definitions, Thoughts and Processes: Engineering design as stated by Dym et al. in2005 is: “a systematic, intelligent process in which designers generate, evaluate, and specifyconcepts for devices, systems or processes whose form and function achieve clients’ objectivesor users’ needs while satisfying a specified set of constraints” (1) . This definition presents designas a thoughtful process that depends on systematic, intelligent generation of design concepts andthe specifications that make it possible to
Conference Session
Laboratory Development in ECE
Collection
2010 Annual Conference & Exposition
Authors
Alexander Ganago, University of Michigan; Inger Bergom, University of Michigan; Britton Wolfe, Indiana University–Purdue University Fort Wayne
Tagged Divisions
Electrical and Computer
can pass on their experiential knowledge to the next.”More information about the wiki (including screen shots) is provided in the Appendix.Research Questions and Methodology Our work addresses the following questions: 1) In what ways do TAs use the website,and which of its parts are most helpful for TAs’ teaching and the improvement of their teaching?2) Is there any difference in website usage between the new TAs and the TAs who have alreadytaught the course? 3) What prompts TAs to add information to the wiki, and what inhibits themfrom adding information? Our research tools include online questionnaires for TAs, focus groups, and statisticsabout website usage. We gathered data from two semesters — winter 2009 (Jan.–Apr
Conference Session
Thermodynamics, Fluids, and Heat Transfer II
Collection
2010 Annual Conference & Exposition
Authors
Amir Karimi, University of Texas, San Antonio; Randall Manteufel, The University of Texas at San Antonio
Tagged Divisions
Mechanical Engineering
moistair. It provide several examples demonstrating the efficiency of “Solver” and “Goal Seek” toolsof Excel in solving problems requiring iterative processes.Definitions and Basic Equations PsychrometricsThe following paragraphs provide the basic definitions and equations used in psychrometricanalysis.At low pressures a mixture of air and water vapor behaves as an ideal gas. Therefore, ideal gasequations can be used for thermodynamic analysis of moist air close to atmospheric pressures.The equation of state for ideal gases can be expressed in the following forms: PV ? nR T ? mRT (1)where, R is the universal gas constant, R ? R M , and M is the molecular weight of
Conference Session
Industrial Interactions and Educational Resources
Collection
2010 Annual Conference & Exposition
Authors
Eric Roe, Polk Community College - Corp. College; Ernie Helms, Polk Community College - Corp. College; Bob Lachford, RWD Technologies; Rick Johnson, Mosaic Company
Tagged Divisions
Manufacturing
trained.The Solution – A Competency Based Combined Crafts Apprenticeship ProgramModern manufacturing demands a workforce with postsecondary education credentials, and theadaptability to respond immediately to changing economic and business needs. The Mosaic/PSCcombination crafts apprenticeship program is meeting these demands though competency basedlearning and lifelong learning strategies that enable workers to advance their skills and remaincompetitive in the global economy. The final program outlined in Figure 1 and Table 1, creates afive unit program that provides the skills and knowledge needed for Mechanics / Millwrights andElectrical, Instrumentation & Automation Technicians. These five “program completion points”(PCPs) break the
Conference Session
Innovative Instructional Strategies and Curricula
Collection
2010 Annual Conference & Exposition
Authors
Robert Homolka, Kansas State University, Salina; Greg Stephens, Kansas State University, Salina
Tagged Divisions
Mathematics
tournaments and the College World Series two times andat the professional level (National League) a couple of times. Throughout this lengthy career, Igathered numerous stories to share (See Appendix A). Here are three abbreviated sample storiesused: 1. The pitching coach at WSU, while objecting to my strike zone, kicked dirt on the entire plate. He proceeded to uncover a two inch space down the middle of the plate and commented that was my strike zone! What percentage of the plate did he uncover? 2. While umpiring a major league game, Davey Johnson the manager of Cincinnati, questioned why a pitch was not called a strike which would have resulted in strike three. The batter hit the next pitch for a home
Conference Session
College-Industry Partnerships: Bringing Industry into the Curriculum Development and Design Cycle
Collection
2010 Annual Conference & Exposition
Authors
Tammy Baldwin, Schweitzer Engineering Laboratories, Inc.; Marisa Hemingway, Schweitzer Engineering Laboratories, Inc
Tagged Divisions
College-Industry Partnerships
and growth opportunities. We will continue toimprove and monitor our progress while adapting to fit industry, collegiate and individual needs.Bibliography[1] Electric Power Engineering Education Resources 2005-2006 IEEE Power Engineering Society CommitteeReport. The Power Engineering Education Committee (PEEC) Task Force on Educational Resources. IEEETransactions on Power Systems, Vol 23, No.1, February 2008, pp. 1–24.[2] National Science Foundation. “Report of the National Science Foundation Workshop on the Future PowerEngineering Workforce (Held November 29-30, 2007).” September 2008. Available:http://ecpe.ece.iastate.edu/nsfws/Report%200f%20NSF%20Workshop.pdf.[3] Task Force on America’s Future Energy Jobs. National Commission on Energy
Conference Session
Student Paper Presentation
Collection
2010 Annual Conference & Exposition
Authors
Melanie Watson, Louisiana Tech University; Krystal Corbett, Louisiana Tech University; Kyle Prather, Louisiana Tech University; Jenna Carpenter, Louisiana Tech University; Stanley Cronk, Louisiana Tech University
Tagged Divisions
Students Constituent Committee
’ respective mentorships, a set of tips was generated from theadvice of experienced faculty and influential relevant works to aid other graduate studentinstructors in maximizing their effectiveness in teaching2, 3. The following is a list of the tips indecreasing order of perceived importance from faculty. 1. Focus on the students' learning of the material as opposed to the graduate student's performance as an instructor. 2. Teach the curriculum alongside a professor and use their feedback 3. Exhibit confidence to gain respect. 4. Become comfortable with content knowledge through lecture preparation, practice, and proven lesson plans. 5. Dress professionally. 6. Be comfortable with making mistakes. 7. Keep it
Conference Session
Enhancing K-12 STEM Education with Engineering
Collection
2010 Annual Conference & Exposition
Authors
Tom Benton, University of Texas, Austin; Taylor Martin, Univ of Texas at Austin
Tagged Divisions
K-12 & Pre-College Engineering
scientists are related but different, engineeringin the classroom demands a different style of instruction than may be effective in the science ormath classroom. Style of instruction aside, high school science and math courses rest on afoundation of relatively well-defined content; contrast this with Koen’s definition of theengineering method as “the strategy for causing the best change in a poorly understood situationwithin the available resources”1. Even retreating from this abstract definition and focusing onmore familiar territory such as electrical or mechanical engineering does not necessarilyilluminate the fundamental engineering content these disciplines share. An extensive NationalAcademies survey on the present state and future of K-12
Conference Session
Chemical Engineering Education: Underclass Years
Collection
2010 Annual Conference & Exposition
Authors
Valerie Young, Ohio University-Athens
Tagged Divisions
Chemical Engineering
anEFLC. Also, the strategies resulting in high yields for EFLC participation and course evaluationparticipation should be investigated for marketing and evaluating other retention interventions.Table 1. Math / Chemistry enrollments of Russ College freshmenMath Course All Russ College freshmen Fall Course EnrollmentAlgebra 14 %Pre-Calculus 42 %Calculus I 23 %Calculus II 15 %Other / No Math 5%General Chemistry 52 %Self-reported enrollments of the electronic survey respondents are in similar proportions to thosetypical of all Russ College freshmen (Table 1), suggesting that this small sample is notnecessarily atypical of the population. The electronic survey’s self-reported
Conference Session
e-Learning Course Development and Instruction
Collection
2010 Annual Conference & Exposition
Authors
Michael Kozak, University of Dayton
Tagged Divisions
Continuing Professional Development
question regarding perceived preparedness was quantified by coding responses asfollows: Strongly agree was assigned a 1, agree a 2, neutral a 3, disagree a 4, and stronglydisagree a 5. A one sample t test was performed on the differences in the ratings for individualdata. Pearson’s correlation coefficient was determined between the individual studentperformances for all eight questions and the individual student perceived perception ofunderstanding.ResultsThree students chose to not have their responses included in the study. Eight students did notcomplete or return all sections of the survey and their answers were not included in the analysis.That left thirty-nine students that were used for the analysis. Table 1 shows the proportion ofcorrect
Conference Session
Multidisciplinary First Year Programs
Collection
2010 Annual Conference & Exposition
Authors
Andrew Lowery, West Virginia University; Steve Kane, West Virginia University; Vicki Kane, West Virginia University; Robin Hensel, West Virginia University; Gary Ganser, West Virginia University
Tagged Divisions
First-Year Programs
diligently in both subjects. Sincestudents historically perform well in freshman engineering, the expected result, if this experimentis successful, would be improved grades in calculus.In this experiment, three joint projects were defined to illustrate the following math concepts:(1) functions, composition of functions, discrete and continuous variables; (2) exponentialgrowth and decay; and (3) rate of change, specifically focusing on Newton’s Law of Cooling.Each project presents a fictitious real world problem that puts the students in the context of beingthe consulting group that needs to develop the solution to the problem. The problem must beunderstood analytically (the part done in math recitation and continued for homework) as well
Conference Session
Sustainable Energy Education
Collection
2010 Annual Conference & Exposition
Authors
Joshua Goldade, University of North Dakota; Tessa Haagenson, University of North Dakota; Hossein Salehfar, University of North Dakota; Mike Mann, University of North Dakota
Tagged Divisions
Energy Conversion and Conservation
curriculum. Page 15.357.14Bibliography[1] Bacharach, Inc. 2009. [Online]. Available: http://www.bacharach-inc.com/leakator-10.htm.[2] Barbir, Frano. PEM Fuel Cells. Burlington, MA: Elsevier Academic Press. 2005.[3] Chroma Ate Inc. 2010. [Online]. Available: http://www.chromaate.com/product/63200_series_High_Power_DC_Electronic_Load.htm.[4] EG&G Technical Services, Inc., Fuel Cell Handbook (Seventh Edition). Prepared for the U.S. Department of Energy. 2004. [Online] Available: http://www.netl.doe.gov/technologies/coalpower/fuelcells/seca/refshelf.html.[5] Engineering Accreditation Commission. (Accreditation Board of Engineering Technology
Conference Session
Embedded System Design
Collection
2010 Annual Conference & Exposition
Authors
Paul Weber, Lake Superior State University
Tagged Divisions
Electrical and Computer
a group of their peers that the application is commercially and ethically viable. Surveyresults were taken from three different classes using a 9-value Likert scale. The current researchwill explain the pedagogical basis for using competition in such presentations and a discussion oftrade-offs, observations of how to implement such presentations at different student levels, andtheir impact on student motivation.1. IntroductionIt is the role of every engineering degree-granting institution to make sure their students have asolid background in the core topics of their specific field as well as engineering in general. Asengineers, they must then be able to integrate this knowledge in order to utilize a more holisticview4 when designing
Conference Session
Issues and Directions in ET Education & Administration: Part III
Collection
2010 Annual Conference & Exposition
Authors
Saeed Khan, Kansas State University-Salina; Lucy Kollhoff, Kansas State Univerty; Michael Kollhoff, Salina South High School
Tagged Divisions
Engineering Technology
introductory course a part of their proposed STEM pathway.Qualified high school students will also be able to pick other existing four-year collegeSTEM offerings as concurrent credit or dual credit.The STEM course (or its adapted form) can be used to facilitate a three-tiered articulationthat also involves two-year programs (Fig. 1). With two-year programs, the problem liesin the inherent difficulty of determining university course equivalency for AAS technicalcourses; a dilemma not characteristic of Associate of Arts (AA) transfer initiatives. Whentransferring to a four-year program, direct equivalency is not always possible due toregulatory requirements; while our immediate focus is on the STEM course, in anoutcome-based culture, it should be
Conference Session
Engaging Students
Collection
2010 Annual Conference & Exposition
Authors
Junko Munakata-Marr, Colorado School of Mines; Jennifer Schneider, Colorado School of Mines; Barbara Moskal, Colorado School of Mines; Carl Mitcham, Colorado School of Mines; Jon Leydens, Colorado School of Mines
Tagged Divisions
Environmental Engineering
engineering students often failto appreciate critical interrelations between technical and nontechnical aspects of sanitation. Toaddress this deficiency, a case-study module on sanitation for the developing world wasimplemented in a senior/graduate level onsite water reclamation course. The goal was to increasestudent awareness of the interplay between technical and nontechnical complexities whendesigning and implementing sanitation systems in both the developed and developing world.Learning objectives included increasing student familiarity with (1) perceptions and treatmentoptions of sanitary waste in developing countries and (2) nontechnical constraints and issues(such as economic, social, cultural, political, and ethical) associated with
Conference Session
Enhancing K-12 STEM Education with Engineering
Collection
2010 Annual Conference & Exposition
Authors
Steve Macho, Buffalo State College
Tagged Divisions
K-12 & Pre-College Engineering
several successful Engineering Technology programs and a TechnologyEducation program within our department. In 2007, faculty these programs workedtogether to provide engineering education professional development experiences fornearly 400 teachers; who in turn have taught thousands of K-12 students. This wasfacilitated with the assistance of a $1.7 million grant, and visiting faculty from severalleading design centers in England. This conceptual framework is partially a result of thefindings of that project. Within our Technology Education program, this is ourframework for preparing technology teachers. These teachers promote technologicalliteracy and engineering. The four elements of the framework are 1) Design, 2) Living, 3) Productivity
Conference Session
Faculty & Program Exchanges: Internationalizing, Collaborations, Interactions
Collection
2010 Annual Conference & Exposition
Authors
Vinod Lohani, Virginia Tech; Ricky Castles, Virginia Tech; Gary Riggins, Virginia Tech
Tagged Divisions
International
  The culture of education [0] [1]. Bruner proposed that a learning curriculum could be arranged sothat the central questions, or themes in a discipline, would be returned to again and again aslearners advance in their knowledge and intellectual capacity. A 7-step process is developed toimplement the spiral curriculum in the bioprocess engineering and details are presented in [2]and [3]. All workshop participants were introduced to the spiral curriculum process adopted bythe DLR project investigators in reformulating the curriculum of the bioprocess engineering. TheDLR project investigators have conducted spiral curriculum workshops at national andinternational sites [2]. In addition, a number of hands-on engineering learning activities
Conference Session
Design in BME Education
Collection
2010 Annual Conference & Exposition
Authors
Eric Kennedy, Bucknell University; Donna Ebenstein, Bucknell University
Tagged Divisions
Biomedical
conventionalmachining [1]. These skills are vital for engineers to communicate design ideas, and a basicunderstanding of manufacturing technology helps enable students to consider how a design onpaper might be turned into a physical prototype. Faculty observations and student and alumnifeedback have indicated that these skills are vital for success in classroom design projects suchas senior design, as well as for careers in industry [2]. Page 15.482.2Within the biomedical engineering curriculum at Bucknell University, a fabrication andexperimental design course is integrated into a four course design sequence where two coursescomprise the senior capstone
Conference Session
Engineering Technology Progress Reports: Part I
Collection
2010 Annual Conference & Exposition
Authors
Kenneth Stier, Illinois State University
Tagged Divisions
Engineering Technology
ABET. The focus ofthis transition was on developing effective and sustainable assessment model that would positionthe program for meeting TAC ABET Accreditation requirements. Also presented are examplesof the templates developed for outcomes assessment and a description of the process theEngineering Technology faculty went through to adopt this current assessment plan.Moving the Existing Program to Outcomes-Oriented TC2K CriteriaThe original assessment model that had been used for previous accreditation reviews wasdeveloped based on MU’s Board of Higher Education recommendations and following themodels suggested by Sarapin11 and Strong et al12. The following was MU’s engineeringtechnology assessment model:Step 1 – Develop a mission
Conference Session
Attracting Young MINDS in Engineering - Part II
Collection
2010 Annual Conference & Exposition
Authors
Lauren Thomas, Virginia Tech; Michael Smith, National Society of Black Engineers
Tagged Divisions
Minorities in Engineering
without a similar background a greater motivation to continue their own technical developmentPrior research and outreachThe research objectives of the TORCH program also rely heavily on four primary categories ofprior research: (1) engineering outreach models for females (2) engineering education outreachprograms and practices (3) the lack of formal K-12 engineering education and (4) persistence,mentoring and goal alignment. Again, the differences of program assessment and research areduly noted, however much of the literature is assessment in nature. We still refer to thesepublications as a baseline for developing the program and the research agenda.Engineering outreach models for femalesIn recent years several organizations, universities
Conference Session
Computer Education Innovations I
Collection
2010 Annual Conference & Exposition
Authors
David Ahlgren, Trinity College; Igor Verner, Technion-Israel Institute of Technology
Tagged Divisions
Computers in Education
persons with severe disabilities is increasing and will continue to grow as the population ages[1]. Many persons with disabilities benefit from an assistive technology device, an “item, pieceof equipment, product or system, whether acquired commercially off the shelf, modified, orcustomized, that is used to increase, maintain, or improve the functional capabilities of personswith disabilities. “[2]. In a 2005 survey by the U.S. Department of Education, National Instituteon Disability and Rehabilitation Research, 64% of respondents used some assistive technology.The most frequently used were devices that enhance mobility (canes, crutches, walkers, scootersand wheelchairs), hearing aids, and oxygen tanks. Most respondents who used AT said it
Conference Session
Teaching Technological Literacy - College Courses and Minors
Collection
2010 Annual Conference & Exposition
Authors
Richard Doyle, Penn State University; Richard Devon, Pennsylvania State University
Tagged Divisions
Technological Literacy Constituent Committee
our lives, from enabling citizens to perform Page 15.1184.2 routine tasks to requiring that they be able to make responsible, informed decisions that affect individuals, our society, and the environment. Citizens of today must have a basic understanding of how technology affects their world and how they exist both within and around technology.”6While persuasive in general, there are many caveats to these propositions:1. It is not possible to be literate about all, or even most, technologies. For example, doctors,electrical engineers, material scientists, biotechnologists, and chemical engineers, typically livein mutually
Conference Session
Enhancing CE Learning Through Use of Technology
Collection
2010 Annual Conference & Exposition
Authors
Monique Head, Texas A&M University
Tagged Divisions
Civil Engineering
responses.Why Use Clickers?The use of clickers or Classroom Performance System (CPS) devices is not a new application oftechnology. Previous studies have shown the effectiveness of the clicker technology to revealingconcept retention and evaluating short-term retention.1-3 However, the manner in which they canbe used is vast and may be seemingly appropriate for some engineering courses to stimulate thelearning environment and provide real-time assessment for both the students and instructor.Students can respond to multiple choice, yes/no, Likert scale, and true/false questions along withproviding numeric responses and even responses to questions posed "on the fly" by theinstructor. The CPS software enables the instructor to display the questions via
Conference Session
Tricks of the Trade in Teaching II
Collection
2010 Annual Conference & Exposition
Authors
Rungun Nathan, Pennsylvania State University, Berks
Tagged Divisions
New Engineering Educators
isabout “Fill-in Worksheets”, a tool that was developed to increase student engagement inclassroom and allows for incorporating PBL, AL and CL along with Peer Instruction (PI).The paper describes the steps and thought process that was used in developing the fill-inworksheets over the past several years. The worksheets have enabled the author toincrease student engagement, include AL, CL and implement PI in the classroom.Introduction“Educators, researchers and policy makers have advocated student involvement forsometime as an essential aspect of meaningful learning.”1 To engage students, educatorshave used techniques like active2 and cooperative learning3, 4, inquiry and problem basedlearning, team projects, service learning and undergraduate
Conference Session
Sustainable Energy Education
Collection
2010 Annual Conference & Exposition
Authors
Connie Gomez, University of Texas at El Paso; Heidi Taboada, University of Texas at El Paso; Jose Espiritu, University of Texas at El Paso; Noe Vargas Hernandez, The University of Texas at El Paso
Tagged Divisions
Energy Conversion and Conservation
. Moreover,increasing numbers of manufacturers are beginning to evaluate their products and even theirproduct packaging for sustainability, whether to meet mandatory retail initiatives or to reap someof the rewards associated with greater environmental stewardship. This shift in product designmeans that engineering education needs to produce engineers that can provide technologicalinnovation while protecting the environment. These demands also mean that universities acrossthe nation need to build bridges between undergraduate engineering education and sustainabilityengineering in both research and industry.1 This paper describes an approach to includesustainability engineering within an existing engineering program through 1) curriculumdevelopment
Conference Session
Enhancing K-12 STEM Education with Engineering
Collection
2010 Annual Conference & Exposition
Authors
Taylor Martin, University of Texas, Austin; Tom Benton, University of Texas, Austin; William McKenna, University of Texas, Austin; Pat Ko, University of Texas at Austin
Tagged Divisions
K-12 & Pre-College Engineering
$&75$16)(52)$'$37,9((;3(57,6(7275$16)250(1*,1((5,1*('8&$7,217D\ORU0DUWLQ8QLYHUVLW\RI7H[DV$XVWLQ 7D\ORU0DUWLQUHFHLYHGD%$LQ/LQJXLVWLFVDQGDQLQLWLDOWHDFKLQJFHUWLILFDWLRQIURP'DUWPRXWK &ROOHJHLQDQ06LQ3V\FKRORJ\IURP9DQGHUELOW8QLYHUVLW\LQDQGD3K'LQ (GXFDWLRQIURP6WDQIRUG8QLYHUVLW\LQ6KHMRLQHGWKHIDFXOW\DWWKH8QLYHUVLW\RI7H[DVDW $XVWLQLQ+HUSULPDU\UHVHDUFKLQWHUHVWLVKRZSHRSOHOHDUQFRQWHQWLQFRPSOH[GRPDLQV IURPDFWLYHSDUWLFLSDWLRQERWKSK\VLFDODQGVRFLDO6KHLVFRRSHUDWLQJZLWKORFDOHOHPHQWDU\ VFKRROVWRLPSURYHDVVHVVPHQWWRROVIRU\RXQJFKLOGUHQVPDWKHPDWLFVDQGWRH[DPLQHKRZ KDQGVRQDFWLYLWLHVLPSDFWPDWKHPDWLFVOHDUQLQJDQGLQYHVWLJDWLQJWKHGHYHORSPHQWRIDGDSWLYH H[SHUWLVHWKURXJKFRRSHUDWLRQZLWKWKH9D17
Conference Session
NSF Grantees Poster Session
Collection
2010 Annual Conference & Exposition
Authors
Tzu-Liang Tseng, University of Texas, El Paso; Ryan Wicker, UTEP; Rong Pan, Arizona State University; Carolyn Awalt, The University of Texas at El Paso
. Awalt teaches online courses in curriculum theory, videoconferences weekly for her educational technology classes, and teaches instructional design classes at Fort Bliss. Dr. Awalt has worked with El Paso Independent School District as a technology professional developer and as a program evaluator. She coauthored a Transition to Teaching Grant for the Department of Education for almost $1 million, and a Hewlett Packard grant to expand the use of table PCs and study the impacts of mobile technology resources on Engineering and Education students at UTEP. Page 15.504.1© American Society for