Collection

1998 Annual Conference

Authors

William J. de Kryger; David A. Lopez

[GZEJCPIGKUVQRTQXKFGCPQRRQTVWPKV[HQTGCEJITQWRVQGZRGTKGPEGVJGVGEJPKECNEWNVWTCNCPFUQEKCNCURGEVUQHGCEJQVJGTIUEQWPVT[%/7JCUVCMGPQPVJGTGURQPUKDKNKV[QHFGXGNQRKPICPFEQQTFKPCVKPIVGEJPKECNRTQLGEVUUJCTGFD[DQVJWPKXGTUKVKGU6JGRTQLGEVUWUWCNN[HQEWUQPCPCURGEVQHCWVQOQVKXGCPFQTGNGEVTQPKEVGEJPQNQI[CPFTGSWKTGVJGRCTVKEKRCVKQPQHUVWFGPVUCPFHCEWNV[HTQODQVJEQWPVTKGU2TQLGEVFGUKIPCPFKORNGOGPVCVKQPWUWCNN[KPXQNXGTGUGCTEJU[UVGOUGPIKPGGTKPICPFCRTCEVKECNCRRNKECVKQPYKVJKPKPFWUVT[I. INTRODUCTIONA. History and Description of the ExchangeThe genesis of this exchange has its roots in a Sister Cities program which was initiated in 1989,with Vladimir, Russia, a city of about 400,000 people. Vladimir is also the home of VladimirState University (VSU), the premier engineering university in that region of

Collection

1998 Annual Conference

Authors

Wayne Hager; Jacques Lesenne; Dominique Saintive; Richard Devon

Session 3148 A French - American Collaboration in Engineering and Technology Education Wayne Hager, Richard Devon The Pennsylvania State University Jacques Lesenne, Dominique Saintive The Université d’Artois at BethuneAbstract:With the globalization of the economy, it is becoming increasingly important for engineering andtechnology graduates to have international and cultural opportunities and experiences as part oftheir undergraduate curricula. This paper reports on the value of using a multi

Collection

1998 Annual Conference

Authors

Sohail Anwar

International Collaboration in Engineering and Technology Education: A Case Study Sohail Anwar Penn State Altoona ABSTRACTThis paper describes an engineering and technology education collaboration between the InstitutUniversitaire de Technologie (IUT) housed in the Bethune campus of the Universite′d’Artois inFrance and the Altoona College of The Pennsylvania State University (Penn State Altoona). Thiscollaboration embraces faculty exchanges, short-term student industrial placements,teleconferencing, and curriculum development.The Universite′d’Artois houses programs in engineering

Collection

1998 Annual Conference

Authors

Mark A. Shields

Session 3661 Collaborative Teaching: Reflections on a Cross-Disciplinary Experience in Engineering Education Mark A. Shields University of VirginiaIntroductionMost of us know a lot more about cooperative learning than about collaborative teaching. We arealso far more sympathetic to the former than the latter. The principled virtues and practicalbenefits of having our students work together in teams seem altogether less attractive when weenvision ourselves joined in (chained to?) a common teaching enterprise. While collaborativelearning seems to offer an

Collection

1998 Annual Conference

Authors

K. Swyler; A. Peskin

BNL’s technicalprograms. Semester students receive academic credit for the experience. A newcommunity college faculty-student research program is intended to help the schoolsdevelop their own resources in engineering technology and other areas. The Laboratory isalso a member of the Northeast Partnership for Environmental Technology Education(NE PETE), an association of community and technical colleges and other organizationsfocused on providing training for HAZMAT technicians.ConclusionIt has long been recognized that quality engineering education should present the studentwith an environment that duplicates as much as possible that which the graduate willencounter in industry. And there is growing evidence that collaboration with theindustrial

Collection

1998 Annual Conference

Authors

K. Swyler; A. Peskin

BNL’s technicalprograms. Semester students receive academic credit for the experience. A newcommunity college faculty-student research program is intended to help the schoolsdevelop their own resources in engineering technology and other areas. The Laboratory isalso a member of the Northeast Partnership for Environmental Technology Education(NE PETE), an association of community and technical colleges and other organizationsfocused on providing training for HAZMAT technicians.ConclusionIt has long been recognized that quality engineering education should present the studentwith an environment that duplicates as much as possible that which the graduate willencounter in industry. And there is growing evidence that collaboration with theindustrial

Conference Session

Integrating Ethics into the Curriculum

Collection

1998 Annual Conference

Authors

Michael E. Gorman, University of Virginia

Tagged Divisions

Liberal Education (LED)

., Stocker, J., & Mehalik, M. M. (1997, ). Using detailed, multimedia cases toteach engineering ethics. Paper presented at the American Society for Engineering Education,Milwaukee, WI.Okada, T., & Simon, H. A. (1997). Collaborative discovery in a scientific domain. CognitiveScience, 21(2), 109-146. Page 3.265.4

Conference Session

Integrated Humanities and Social Sciences Programs (3661)

Collection

1998 Annual Conference

Authors

Michael E. Gorman

Tagged Divisions

Liberal Education (LED)

., Stocker, J., & Mehalik, M. M. (1997, ). Using detailed, multimedia cases toteach engineering ethics. Paper presented at the American Society for Engineering Education,Milwaukee, WI.Okada, T., & Simon, H. A. (1997). Collaborative discovery in a scientific domain. CognitiveScience, 21(2), 109-146. Page 3.266.4

Collection

1998 Annual Conference

Authors

Lucy C. Morse; Jack Selter

Session 1149 Collaboration in Delivering Engineering Technology at a Distance Lucy C. Morse, Ph.D., Associate Professor, Engineering Technology Jack Selter, Director of External Resources, College of Engineering University of Central FloridaAbstractThe goal of Engineering Technology at a Distance is to deliver a learner-centered Bachelor ofScience degree at a distance through the collaboration of a university, community colleges, andindustry. This paper gives techniques for effective delivery of engineering technology with easyaccess from the community colleges and industry. This will enable both

Collection

1998 Annual Conference

Authors

Randall L. Musselman

Session 1232 Personal Responsibility in Collaborative Lab Courses Randall L. Musselman Department of Electrical Engineering U.S. Air Force Academy, COABSTRACTWhile the concept has been around for some time, cooperative learning is often avoided due tothe differences in students’ individual levels of responsibility. This paper relates the personalexperience of one instructor experimenting with cooperative learning in a microwave-measurements lab. An overall purpose that provides continuity between weekly labs became akey ingredient to the success of

Collection

1998 Annual Conference

Authors

Ian R. Simpson; Brian Manhire

Session 2660 Engineering Education in France Ian Simpson and Brian Manhire Ecole Nationale Supérieure des Télécommunications de Bretagne / Ohio UniversityAbstract— The aim of this paper is to present the main characteristics of Engineering Educationin France. For historical reasons, the French system is not easy to analyze succinctly and theauthors have had to resort to some oversimplifications. Aspects such as the mutual recognition ofdegrees and professional qualifications have not been examined in this paper. I. INTRODUCTION TO THE FRENCH ENGINEERING EDUCATION SYSTEM Compared to

Collection

1998 Annual Conference

Authors

Audeen W. Fentiman

Session 3461 Section 3461 IMPROVING ENGINEERING STUDENTS’ WRITING THROUGH COLLABORATION BETWEEN WRITING CENTERS AND ENGINEERING FACULTY Audeen W. Fentiman The Ohio State UniversityIntroductionEngineering Graphics 166 (EG166) is required of all beginning engineering students atThe Ohio State University. The course has always focused on graphical communications.In it, students learn how to make 3-D sketches that would allow a non-technical audienceto understand their ideas for new equipment or products, detailed drawings that

Collection

1998 Annual Conference

Authors

Joan A. Burtner; Laura Moody

Education, October 1995, pp. 361-367.6. Yokomoto, C. and R. Ware,. “Variations of the Group Quiz that Promote Collaborative Learning”, ASEE/IEEE Frontiers in Education Conference Proceedings, 1997, Session T4H1.7. Sears, W., “Implementing Cooperative Learning in a Well-Established EET Curriculum,” ASEE Annual Conference Proceedings, 1995, Session 1675.8. Jones, J. and D. Brickner, “Implementation of Cooperative Learning in a Large-Enrollment Basic Mechanics Course,” ASEE Annual Conference Proceedings, 1996, Session 2230.9. Howell, K. “Introducing Cooperative Learning into a Dynamics Lecture Class,” Journal of Engineering Education, January 1996, pp. 69-72.10. Lavelle , J., K. Needy, H. Umphred .”Engineering Economy: A Follow

Collection

1998 Annual Conference

Authors

Lang-Wah Lee; Tamer Ceylan

) design of experimental procedurewith statistical design of experiments; and (4) evaluation of industrial products. Examples are usedto illustrate the advantages and drawbacks of each method.I. INTRODUCTION To educate a new generation of engineers for the twenty-first century, engineering educatorsface many challenges such as the development of students’ ability in critical thinking, creativity,collaborative work, and communication. Laboratory education can play a pivotal role in attainingthese goals. However, due to the limitation of traditional laboratory teaching, its potential benefitshave never been fully realized. The problem becomes more acute if the laboratory course isequipment-intensive. Since students are usually not familiar

Collection

1998 Annual Conference

Authors

Kathi Cahill; Joe C. Guarino

problems, while reinforcing important concepts in staticsand dynamics. To ensure effective implementation and evaluation of the DBEE project wecollaborated with the Department of Instructional and Performance Technology (I&PT), agraduate program at Boise State University. Faculty in the I&PT department specialize ininstructional design, distance education, and evaluation. The objective of the collaborative effortbetween faculty in engineering and faculty in I&PT is to develop a structured environment for theeffective delivery, assessment, and continued improvement of Design-Based EngineeringEducation. This paper summarizes the results available at the midpoint of the DBEE project, whichbegan in the Fall semester of 1997

Collection

1998 Annual Conference

Authors

Surya Kalidindi; Philip Perdikaris; John Lannutti; John DiNardo; Gary Ruff; Charles McMahon; Jed S. Lyons; Alan Lawley; Linda Schadler

Session 1364 The NSF Gateway Engineering Education Coalition Materials Project Jed Lyons - University of South Carolina Surya Kalidindi, Alan Lawley, Gary Ruff, John DiNardo - Drexel University John Lannutti - Ohio State University Charles McMahon - University of Pennsylvania Philip Perdikaris - Case Western Reserve University Linda Schadler - Rensselaer Polytechnic InstituteABSTRACT The Gateway Coalition Materials Project is a collaborative effort to improve the teaching ofMaterials Science and Engineering fundamentals

Collection

1998 Annual Conference

Authors

Aaron A. Jennings

Session 3251 Introduction to Educational Use of Environmental Engineering Software Aaron A. Jennings Department of Civil Engineering Case Western Reserve UniversityAbstract Between May, 1995 and August 1997 collaborators from seven Gateway consortiumuniversities worked to develop shared resource modules to help support EnvironmentalEngineering education. This paper discusses how module development priorities wereestablished based on initial prototype results. The paper also discusses the general criteriathat were used to identify

Collection

1998 Annual Conference

Authors

Roman Z. Morawski; Jerzy Woznicki; Andrzej Krasniewski

, System for Quality Assessment in Higher Education Institutions (developed and verified by the Council for Higher Education), Council for Higher Education, Warsaw, 1996 (in Polish).10. H. R. Kells, Self-Regulation in Higher Education: A Multi-National Perspective on Collaborative Systems of Quality Assurance and Control, Higher Education Policy Series 15, Jessica Kingsley Publishers, 1992.11. A. Krasniewski, R. Z. Morawski, J. Woznicki, "Some Underestimated Aspects of Quality Assessment in Engineering Education", Proc. American Society for Engineering Education Annual Conf., (CD-ROM), Milwaukee, June 1997.12. A. Krasniewski, E. Toczylowski, "A Methodology for Development of Flexible and Adaptable Engineering

Collection

1998 Annual Conference

Authors

Ronald J. Bennett

Session 2642Industry/Academia Collaboration: Developing a New Master of Science in Technology Management Degree Program Ronald J. Bennett, Ph.D. Director and Chair Manufacturing Systems and Engineering Page 3.337.1 1AbstractThe University of St. Thomas graduate programs serve a working adult population centered inthe Minneapolis/St. Paul metropolitan area. Degree programs in business, software,manufacturing systems and engineering are provided through a multitude of delivery modesincluding traditional classes, company on-site classes, use

Collection

1998 Annual Conference

Authors

Mark A. Shields; John P. O'Connell

(see below). 4A "strong-program” interpretation of the ABET criteria would stress the importance not just of"supplementing” technical coursework with courses in the humanities and social sciences, butrather building more direct, systematic, and coherent links between the technical andnontechnical components of engineering education. Thus, by this interpretation, a strong liberal-arts foundation would be one that offers at least some coursework which explicitly integratestechnical, social, and ethical analysis/problem-solving. Ideally, such coursework would also bedeveloped and taught collaboratively (to some degree at least) by technical and nontechnicalengineering faculty

Collection

1998 Annual Conference

Authors

Hamid Y. Eydgahi; Saeid Y. Eidgahy

significantattention in recent years as a plausible solution to developing a more relevant approach toteaching and learning.Educational ModelsResponding to the widespread demand for a multifunctional engineering technician, New JerseyCenter for Advanced Technolgical Education is developing a Mecomtronics EngineeringTechnology Associate Degree program to produce a technician who, as a team player, is skilledin mechanics, computer, telecommunication and electronics. This program approaches thedevelopment of curriculum and instructional materials from an interdisciplinary, project-centeredpoint of view and encourages both collaborative teaching and learning. It is anticipated that theinnovative curriculum, instructional materials and delivery of courses will

Collection

1998 Annual Conference

Authors

Thomas R. Williams; Judith Ramey

column addresses the secondmajor failing of many curriculum proposals written by engineering educators: an apparentunfamiliarity with the literature of instructional theory, as evidenced by a paucity of citations tothat literature. For instance, assuming that it indeed is the case that traditional approaches toteaching physics are "too abstract," that they are "ineffective," and that they adversely affectstudent recruitment to the sciences and engineering, what evidence exists that would suggest that"hands-on" or collaborative versions of freshman physics would ameliorate the problem? Or, inthe absence of such evidence, what can at least be inferred from the similar work of others? Ifthere is no research directly related to the teaching of

Collection

1998 Annual Conference

Authors

Susan Ambrose

implementation not only to therelevant cognitive and educational principles but also to the targeted audience, course goals, andfaculty member's style of teaching. The consulting relationship, I am convinced, works betterwith engineering colleagues than with many other colleagues for a number of reasons: • Engineers understand the nature of the consulting relationship because it is pervasive in the engineering profession. As a result, they are not embarrassed to seek help, nor is their ego threatened. • Engineers are used to collaborating with colleagues, particularly in research. They recognize and value the different skill set and knowledge base colleagues from other disciplines bring to the table

Collection

1998 Annual Conference

Authors

Ben Erwin

Session 1280K-12 Education and Systems Engineering: A New Perspective Ben Erwin Tufts University Center for Engineering Educational Outreach Page 3.385.1 In a classroom in the suburbs of Boston, a class of first-graders are designing snow removal equipment out of LEGO Dacta materials. Before breaking up into groups, they are having a class discussion about different types of equipment - shovels, plows, front-end loaders, etc. One boy raises his hand and says "Can we make up

Collection

1998 Annual Conference

Authors

Melody Ivory; Kathleen Luker; Kathleen Coppock; Erol Tutumluer; David Hill; Christine Masters; Amelia Regan; Alkim Akyurtlu; Eric Matsumoto; Sandra Shaw Courter; Sarah Pfatteicher

Session 0575 The Engineering Education Scholars Program— Preparing a New Generation of Faculty Eric Matsumoto, Christine Masters University of Texas at Austin/Pennsylvania State University Alkim Akyurtlu, David Hill, Melody Ivory Pennsylvania State University/University of California at Berkeley Amelia Regan, Erol Tutumluer University of California at Irvine/University of Illinois at Urbana-Champaign Kathleen Coppock, Sandra Courter, Kathleen Luker, Sarah Pfatteicher

Collection

1998 Annual Conference

Authors

Thomas G. Stanford; Donald Keating

technical competency and an in-depthindustrial experience base in practice.The professional dimensions of the systematic engineering practice and professional leadershipof needs-driven innovation and technology development are now known. They include:• technical competence,• creative problem-solving, systems thinking, and innovation,• professional responsibility,• professional leadership of multidisciplinary groups for needs-driven collaborative creativity,• problem finding and visualization (needs-finding),• program making and strategic thinking,• policy making, value judgement, ethics in technology-social-safety-economic issues. 5. UNIVERSITY - INDUSTRY GRADUATE EDUCATION FOR INNOVATIONThere is now both the conceptual clarity

Collection

1998 Annual Conference

Authors

Ann D. Christy; Marybeth Lima

Page 3.584.1The Accreditation Board of Engineering and Technology (ABET) recently publishedEngineering Criteria 2000, which sets new standards for evaluating, assessing and accreditingengineering programs in North America [1]. The criteria are purposefully vague in nature toencourage innovation in engineering education [2]. Proceedings from the National Conferenceon Outcomes Assessment for Engineering Education [3] reflect educators’ frustration with thisissue. The process for implementing new means of assessment will be iterative in nature, andwill involve collaboration among educators, industry leaders, accreditors, and stakeholders [2].Engineering Criteria 2000 cited the student portfolio as a means for meeting criterion three:program

Collection

1998 Annual Conference

Authors

Andrew S. Crawford

Session 2632 LEADERSHIP EDUCATION AT THE UNIVERSITY OF MICHIGAN ANDREW S. CRAWFORD University of Michigan I. INTRODUCTION The College of Engineering is making “team building” an instructional commitment as partof the revision for our Curriculum 2000. Students will have curricular instruction in aspects of teambuilding and the opportunity to practice these skills in significant team projects during each year oftheir education. Part of our goal is to meet the ABET requirement to demonstrate that our graduateshave “an ability to

Collection

1998 Annual Conference

Authors

James A. Houdeshell; Robert Mott

IndustriesThe primary outcomes of the center's work are a novel associate degree curriculum inmanufacturing engineering technology and a competency-based, modular, activity-based programand pedagogy. The target employer for the graduate of the associate degree program is anyproduct-producing industry. Skills are built in modern manufacturing processes, materials, leanmanufacturing, just-in-time, quality, continuous improvement, and customer satisfaction toprepare graduates to be strong contributors to world-class industrial production operations.These skills are central to overcoming the gaps in manufacturing education as identified by the1996 study conducted by the Society of Manufacturing Engineers (SME) called theManufacturing Education Plan: Phase

Collection

1998 Annual Conference

Authors

Albert L. McHenry; Lakshmi Munukutla, Arizona State University

AC 1998-294: Innovative Educational Partnership for the New CenturyAlbert L. McHenry,Lakshmi Munukutla, Arizona State University Page 3.342.1© American Society for Engineering Education, 1998 Session 1647 Innovative Educational Partnership for the New Century Lakshmi V. Munukutla, Albert L. McHenry Arizona State University EastABSTRACTThe Arizona State University and the Maricopa Community Colleges have a history ofcollaboration that is acclaimed as a model across the nation. However