Collection

2003 GSW

Authors

Alfred J. Jayachandran; Edward S. Kolesar

Design and Operation of a MEMS Microengine Fabricated from Asymmetrical Polysilicon Surface Micromachined Electrothermal Microactuators Alfred J. Jayachandran and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA e-mail: e.kolesar@tcu.edu*Faculty Research Mentor AbstractSeveral electrically-driven microactuators have been

Collection

2003 GSW

Authors

William E. Odom; Edward S. Kolesar

Characterization of Symmetrical and Asymmetrical Polysilicon Surface Micromachined Electrothermal Actuators William E. Odom and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA PH: 817-257-6226 FAX: 817-257-7704 e-mail: e.kolesar@tcu.edu*Faculty Research Mentor AbstractSeveral electrically-driven microactuators have been

Collection

2003 GSW

Authors

Kuldeep S. Rawat; Gholam H. Massiha

Model Driven Robot Simulation: RoboCell Kuldeep S. Rawat, and Gholam H. Massiha Department of Industrial Technology University of Louisiana at Lafayette AbstractRobotics courses are offered in the College of Engineering at University of Louisiana atLafayette. Subjects such as robot applications, end of arm tooling, safety, and analysis of robotspecifications are covered in these courses. These robotics fields have benefited considerably inthe last three decades from the advancement of computer science, as advanced software toolswere developed to study the working of robots. As robots have

Collection

2003 GSW

Authors

Edward S. Kolesar; Matthew D. Ruff

Three-Dimensional Microelectromechanical Systems (MEMS) Structures Assembled from Polysilicon Surface Micromachined Elements Containing Continuous Hinges and Microrivets Matthew D. Ruff and Edward S. Kolesar* Department of Engineering Texas Christian University Tucker Technology Center TCU Box 298640 2840 Bowie Street, Fort Worth, TX 76129 USA PH: 817-257-6226 FAX: 817-257-7704 e-mail: e.kolesar@tcu.edu*Faculty Research Mentor

Collection

1996 Annual Conference

Authors

Paul S. Chinowsky; Jorge A. Vanegas

Session 1221 Combining Practice and Theory in Construction Education Curricula Paul S. Chinowsky and Jorge A. Vanegas Georgia Institute of TechnologyAbstract The development of construction education curricula has undergone several significant changes overthe last several decades. Existing construction programs fall primarily under two categories, constructionengineering and construction management programs. Further, construction education is significantlydifferent at the undergraduate and graduate levels and within engineering and non-engineering

Collection

1996 Annual Conference

Authors

John S. Gillard; Gary P. Maul

Session 3557 Teaching The Tools of Quality Gary P. Maul John S. Gillard The Ohio State University Honda of America Manufacturing Columbus, OH Marysville, OHIntroduction Total Quality Management (TQM) is not the panacea it might have promised to be. However, the tools ofquality used in TQM are of considerable value. Used correctly they can be used to resolve many businessconcerns. Correct use comes from teaching not only the tools

Collection

1996 Annual Conference

Authors

Nelson C. Baker; Paul S. Chinowsky

Session 3515 Technology in the Civil Engineering Classroom: Introduction and Assessment Nelson C. Baker1, Paul S. Chinowsky2 Georgia Institute of Technology Abstract The introduction of innovative technologies into the civil engineering classroom is providingunprecedented opportunities to examine traditional educational methodologies. The development of video,multimedia, and advanced computer modelling technologies provides educators with the tools to divergefrom the static arena of

Collection

1997 Annual Conference

Authors

Dean R. Johnson; S. Hossein Mousavinezhad

Session 3532 ALGORITHMS AND COMPUTER METHODS IN DIGITAL SIGNAL PROCESSING S. Hossein Mousavinezhad, Professor & Chairperson, and Dean R. Johnson, Associate Professor Department of Electrical and Computer Engineering Western Michigan University Kalamazoo, Michigan h.mousavinezhad@wmich.edu dean.johnson@wmich.edu (616) 387-4057 FAX (616) 387-4024 I. INTRODUCTIONDigital Signal Processing

Collection

1997 Annual Conference

Authors

Chandra S. Brahma; Howard C. Biddlecome

''ZECXCVKQPTGOQXGUCOCUUQHUQKNCPFYCVGTRTQFWEKPICTGFWEVKQPQHVQVCNUVTGUUCVVJGDQVVQOQHVJGEWV6JGUQKNQWVUKFGVJGYCNNUCEVUNKMGCUWTEJCTIGCPFECWUGUVJGUQHVVQOGFKWOUQKNDGNQYVJGDQVVQOQHGZECXCVKQPVQOQXGWRYCTFWPNGUUCTGNCVKXGN[UVKHHUQKNUVTCVWONKGUPGCTVJGDCUGQHVJGEWV5WEJOQXGOGPVUCUUQEKCVGFYKVJCFGGREWVOCFGKPUQHVUQKNUCTGRCTVKEWNCTN[NCTIG6JGTKUGQHVJGDCUGKUKPXCTKCDN[CEEQORCPKGFD[CPKPYCTFOQXGOGPVQHVJGUQKNDGNQYVJGGZECXCVKQP6JGDCUGHCKNWTGQHCPQRGPGZECXCVKQPKUQTFKPCTKN[CPCN[\GFWUKPIRTQEGFWTGUHQTHQWPFCVKQPUVCDKNKV[ $CUGHCKNWTGQEEWTUYJGPVJGUWTEJCTIGRTGUUWTG*SFWGVQVJGWPKHQTOUWTHCEGNQCFKPISCPFVJGYGKIJVQHVJGEQNWOPQHUQKNWPKVYGKIJVQHJGKIJV * CFLCEGPV VQ VJG GZECXCVKQP DGEQOGU GSWCN VQ VJG PGV DGCTKPI ECRCEKV[ QH VJG UQKNWPFGTN[KPIVJGDQVVQOQHGZECXCVKQP(KIWTG#EEQTFKPIN[VJGHCEVQTQHUCHGV[CICKPUVDCUGHCKNWTG(5DKUIKXGPD[ (5D0ED5W*S YJGTG0EDDGCTKPIECRCEKV[HCEVQT

Conference Session

Design Methods and Concepts

Collection

2006 Annual Conference & Exposition

Authors

S. Balachandran, University of Wisconsin-Platteville

Tagged Divisions

Design in Engineering Education

2006-84: TEACHING A WEB-BASED GRADUATE COURSE ON TAGUCHIMETHODSS. Balachandran, University of Wisconsin-Platteville Dr. S. Balachandran is a Prof. of Ind. Eng., at UW-Platteville. He owns the consulting firm Process Improvement and has served as a consultant to manufacturing companies, businesses, law firms and government agencies. His areas of interest are ergonomics, continuous process and quality improvement, design of experiments, facilities design, manufacturing system design and simulation. He received B.E. Degree with Honors in Mech. Eng. from the University of Madras, India in 1968, and received M.E. degree with Distinction in Aeronautical Eng. with specialization in rockets

Conference Session

Improving ME instructional laboratories

Collection

2006 Annual Conference & Exposition

Authors

S. Perwez Kalim, Wilkes University

Tagged Divisions

Mechanical Engineering

Conference Session

ECE Poster Session

Collection

2006 Annual Conference & Exposition

Authors

S. Hossein Mousavinezhad, Western Michigan University

Tagged Divisions

Electrical and Computer

2006-1241: ELECTRIC & MAGNETIC FIELDS, TRANSMISSION LINES FIRST?S. Hossein Mousavinezhad, Western Michigan University BIOGRAPHICAL INFORMATION Dr. Mousavinezhad is an active member of ASEE and IEEE having chaired sessions in national and regional conferences. He is IEEE Region 4 Educational Activities Chair and member of the ASEE North Central Section Executive Board. He was the ECE Program Chair of the 2002 ASEE Annual Conference, Montreal, Quebec, June 16-19 and 2003 ASEE ECE Division Chair. Professor Mousavinezhad received ASEE/NCS Distinguished Service Award, April 6, 2002, for significant and sustained leadership. In 1994 he received Zone II Outstanding Campus

Conference Session

Pre-College: Resource Exchange

Collection

2017 ASEE Annual Conference & Exposition

Authors

Pamela S. Lottero-Perdue, Towson University

Tagged Topics

Diversity

Tagged Divisions

Pre-College Engineering Education Division

Paper ID #18460The 2017 Best STEM Books (Resource Exchange)Dr. Pamela S. Lottero-Perdue, Towson University Pamela S. Lottero-Perdue, Ph.D., is Associate Professor of Science Education in the Department of Physics, Astronomy & Geosciences at Towson University. She has a bachelor’s degree in mechanical engineering, worked briefly as a process engineer, and taught high school physics and pre-engineering. She has taught engineering and science to children in multiple informal settings. As a pre-service teacher educator, she includes engineering in her elementary and early childhood science methods courses, and has

Conference Session

Pre-College: Fundamental Research in Engineering Education (2)

Collection

2017 ASEE Annual Conference & Exposition

Authors

Pamela S. Lottero-Perdue, Towson University

Tagged Topics

Diversity

Tagged Divisions

Pre-College Engineering Education Division

Paper ID #18779Elementary Student Reflections on Failure Within and Outside of the Engi-neering Design Process (Fundamental)Dr. Pamela S. Lottero-Perdue, Towson University Pamela S. Lottero-Perdue, Ph.D., is Associate Professor of Science Education in the Department of Physics, Astronomy & Geosciences at Towson University. She has a bachelor’s degree in mechanical engineering, worked briefly as a process engineer, and taught high school physics and pre-engineering. She has taught engineering and science to children in multiple informal settings. As a pre-service teacher educator, she includes engineering in her

Conference Session

Learning from Industry

Collection

2017 ASEE Annual Conference & Exposition

Authors

Trevion S. Henderson, University of Michigan

Tagged Topics

Diversity

Tagged Divisions

Educational Research and Methods

Paper ID #19263Exploring the Post-graduation Benefits of High-Impact Practices in Engi-neering: Implications for Retention and Advancement in IndustryTrevion S. Henderson, University of Michigan Trevion Henderson is a doctoral student in the Center for Higher and Postsecondary Education (CSHPE) at the University of Michigan. He recently earned his master’s degree in Higher Education and Student Affairs at The Ohio State University while serving as a graduate research associate with the Center for Higher Education Enterprise. Trevion also hold’s a Bachelor’s degree in Computer Science and Engineer- ing from The Ohio State

Conference Session

Engineering Physics & Physics Division Technical Session 4

Collection

2017 ASEE Annual Conference & Exposition

Authors

Hyung S. Choi, Greenville College

Tagged Divisions

Engineering Physics & Physics

Paper ID #19526Incorporating Quantum Technologies into Engineering CurriculumDr. Hyung S. Choi, Greenville College Dr. Hyung S. Choi is Professor of Engineering and Physics, Chair of Physics Department, and Director of Engineering Program at Greenville College. Before he came to Greenville in 2013, he served as Director of Mathematics & Physical Sciences Division at the John Templeton Foundation, PA. He was a Visiting Researcher at Wycliff Hall, Oxford University; Visiting Fellow at St. Edmund’s College, Cambridge University; Witherspoon Fellow at CTNS, Berkeley.Dr. Choi received his Ph.D. in Physics from Graduate

Conference Session

Technical Session 1: Issues Impacting Students Learning How to Program

Collection

2019 ASEE Annual Conference & Exposition

Authors

S. Cyrus Rezvanifar, University of Akron

Tagged Divisions

Computers in Education

Paper ID #27559Programming Without Computer: Revisiting a Traditional Method to Im-prove Students’ Learning Experience in Computer ProgrammingMr. S. Cyrus Rezvanifar, University of Akron S. Cyrus Rezvanifar is a Ph.D. student in Biomedical Engineering at The University of Akron. He has also served as a research assistant in Cleveland Clinic Akron General since 2016, where he conducts research on biomechanics of human knee joint and patellar instability. In 2016, he received a doctoral teaching fellowship from the College of Engineering at The University of Akron. Through this teaching program, he has served as an

Conference Session

First-Year Programs: Maker Spaces in the First Year

Collection

2020 ASEE Virtual Annual Conference Content Access

Authors

Jennifer S Mullin, UC Davis

Tagged Divisions

First-Year Programs

Paper ID #29475Developing Technical Self-efficacy through a Maker-inspired DesignProjectDr. Jennifer S Mullin, UC Davis Jennifer S. Mullin is an Assistant Professor of Teaching in the Department of Biological and Agricultural Engineering at UC Davis. Her work concerns the intersection between design, communication and prob- lem solving skills in engineering by enhancing all three through informed instructional choices using a ”learn-by-doing,” hands-on approach. c American Society for Engineering Education, 2020Developing Technical Self-efficacy through a Maker-inspired Design ProjectAbstract:This

Conference Session

Environmental Engineering Division Technical Session 3

Collection

2019 ASEE Annual Conference & Exposition

Authors

Thomas S. Soerens, Messiah College

Tagged Divisions

Environmental Engineering

Paper ID #24605I Kissed Homework Goodbye: Replacing Homework with Online QuizzesDr. Thomas S. Soerens, Messiah College Thomas Soerens is Professor of Engineering at Messiah College. He teaches in Civil and Environmental engineering with specialization in storm water, ground water, and water treatment. He performs design and applied research in water systems in rural developing communities. He is a Professional Engineer and a Certified Ecological Designer. c American Society for Engineering Education, 2019 I Kissed Homework Goodbye: Using Online Quizzes in

Conference Session

Entrepreneurship & Engineering Innovation Division Technical Session 11

Collection

2016 ASEE Annual Conference & Exposition

Authors

Michael S. Lehman, Lehigh University

Tagged Divisions

Entrepreneurship & Engineering Innovation

Paper ID #15257Dedicated Curriculum, Space and Faculty: M.Eng. in Technical Entrepreneur-shipDr. Michael S. Lehman, Lehigh University One will find Michael S. Lehman at the intersection of entrepreneurship, science, and higher education. Dr. Lehman is a Professor of Practice at Lehigh University, co-developing and teaching in the Master’s of Engineering in Technical Entrepreneurship, which received national recognition for its role in talent de- velopment by the University Economic Development Association. The faculty appointment also includes roles with Lehigh’s Baker Institute for Creativity, Innovation and

Conference Session

First-year Programs Division Postcard Session 1: Retention and Student Success Strategies

Collection

2018 ASEE Annual Conference & Exposition

Authors

Krystal S. Corbett, Louisiana Tech University

Tagged Divisions

First-Year Programs

Paper ID #23505Work in Progress: Redesigning Curriculum to Foster Student SuccessDr. Krystal S. Corbett, Louisiana Tech University Dr. Krystal Corbett is a lecturer for the Mechanical Engineering Department at Louisiana Tech Univer- sity. She teaches in their prestigious Living with the Lab first year program as well as other mechanical engineering related courses. She received her B.S. and M.S. in Mechanical Engineering (2008/2010), M.S. in Mathematics (2012), and Ph.D. in Engineering Education (2012) at Louisiana Tech University. Formerly, she was the Director of Curricula at the Cyber Innovation Center (CIC) where she

Conference Session

Grading and Feedback Models in Mechanics

Collection

2020 ASEE Virtual Annual Conference Content Access

Authors

Charles S. White, Norwich University

Tagged Divisions

Mechanics

Paper ID #30062Replacing Graded Homework Assignments in StaticsProf. Charles S White, Norwich University Prof. White received BS, MS and PhD degrees in Mechanical Engineering from M.I.T. He has worked in government research (U.S. Army Materials Technology Lab), private industry (Gillette/P&G, The Velcro Companies, Saint-Gobain) and academia (Northeastern University, Norwich University). His return to academia in 2018 resulted from a desire to give back and share his experiences. Particular areas of exper- tise include constitutive modeling for mechanical behavior of materials, consumer product development, and

Collection

2019 ASEE Zone I Conference & Workshop

Authors

Christian E Lopez; Conrad S Tucker

Implementing gamification in engineering bridge programs: A case study exploring the use of the Kahoot! application Christian E. López 1 and Dr. Conrad S. Tucker1,2 1 Department of Industrial and Manufacturing Engineering, the Pennsylvania State University. 2 School of Engineering Design, Technology and Professional Programs, the Pennsylvania State University.AbstractThis work introduces a case study in which the gamified application Kahoot! was implementedin an engineering bridge program. Students’ Hexad player type is assessed to gain a betterunderstanding of how their player type relates to their perception of application and the gameelements employed. Gamification has shown great

Collection

2020 St.Lawrence Section Meeting

Authors

Agamemnon Crassidis; Daniel S. Kaputa

Conference Session

Capstone Design and Engineering Practice

Collection

2003 Annual Conference

Authors

John Gesink; S. Hossein Mousavinezhad

Session 2282 An ECE Capstone Design Experience John Gesink, S. Hossein Mousavinezhad Associate Professor, Electrical and Computer Engineering / Professor and Chair, Electrical and Computer Engineering Western Michigan University, Kalamazoo Michigan, 49008 The capstone design experience in the Department of Electrical and ComputerEngineering at Western Michigan University is a two-semester sequence of two courses, the firstof the two (ECE Design I) being a 2 credit course while the second (ECE Design II) is 3credits. Students must have

Conference Session

Teaching Strategies in Graphics

Collection

2005 Annual Conference

Authors

S. C. York; Tamara Knott

Supporting a Meaningful Design-Build Challenge for Freshman Engineering Students S. C. York and T. W. Knott Virginia Polytechnic Institute and State University (Virginia Tech)The second semester Introduction to Engineering course taught by the Department ofEngineering Education (EngE) at Virginia Tech contains a semester-long, design-build, team-based project that constitutes a significant portion of each student’s grade in the course. For thepast three years, EngE has directed students toward the ASEE Engineering Design GraphicsDivision (EDGD) freshman design challenge as the required design project and EngE hasutilized the ASEE project as a vehicle

Conference Session

Innovations in the ChE Laboratory

Collection

2004 Annual Conference

Authors

Polly Piergiovanni; S. Scott Moor

Session 2213 Inductive Learning in Process Control S. Scott Moor and Polly R. Piergiovanni Lafayette CollegeAbstractDifferent forms of inductive learning were used to help keep student interest high and to helpsome aspects of process control become intuitive to the students. Both simulation software andlaboratory kits where the students could conduct an experiment in the classroom were used forthe exercises. The exercise either lasted for the full two hours of the class, or was a shortintroduction at the beginning of class. The students’ response to the methods

Conference Session

Emerging Trends in Engineering Education

Collection

2004 Annual Conference

Authors

Hilkat S. Soysal; Oguz Soysal

Session 1793 INTERACTIVE ASSESSMENT OF LEARNING OUTCOMES IN INTRODUCTORY ELECTRICAL ENGINEERING CLASSES Oguz A. Soysal, Hilkat S. Soysal Frostburg State University Department of Physics and Engineering Frostburg, MDAbstractThe paper discusses the student learning outcomes in introductory level electricalengineering courses in terms of ABET criteria for program educational objectives.Courses taught by resident faculty in FSU are based on hands-on classroom and labactivities with one-on-one student-instructor interaction. In addition, web support is

Conference Session

Learning Enhancements for CHE Courses

Collection

2003 Annual Conference

Authors

Polly Piergiovanni; S. Scott Moor

Session 3213 Experiments in the Classroom: Examples of Inductive Learning with Classroom-Friendly Laboratory Kits. S. Scott Moor and Polly Piergiovanni Lafayette CollegeAbstractThe educational literature is full of examples of the effectiveness of inductive and hands onlearning. Laboratory experiments are clearly an excellent place to encourage this type of learning.However, it would be beneficial to mix laboratory material with classroom presentations andproblem solving in a more flexible approach than a traditional

Collection

2001 Annual Conference

Authors

Thomas S. Kuhaneck; Frank Noonan

Session 2478 A DL Course in Risk-based Decision-Making for Marine Safety and Environmental Protection Professionals in the United States Coast Guard Frank Noonan, LCDR Thomas S. Kuhaneck Worcester Polytechnic Institute/U.S.C.G. R&D CenterAbstractThis paper explains the motivation for a proposed course design for marine safety andenvironmental protection professionals in the United States Coast Guard (CG). Thecourse is intended to build competency in risk-based decision-making under a distancelearning (DL), continuing education format. The course design is, first and foremost